mCherry Fluorescent Protein Recombinant Protein
mCherry Fluorescent Protein, Recombinant
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence
Purity
> or = 97% (SDS-PAGE and HPLC).
Synonyms
mCherry Fluorescent Protein; Recombinant; mCherry Fluorescent Protein recombinant protein
Host
E.Coli
Purity/Purification
> or = 97% (SDS-PAGE and HPLC).
Form/Format
Supplied as freeze dried powder. Reconstitute with 100ul sterile ddH2O.
Concentration
~1mg/ml (after reconstitution) (varies by lot)
Sequence
MGSSHHHHHHSSGLVPRGSHMVSKGEEDNMAIIKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSERMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHNEDYTIVEQYERAEGRHSTGGMDELYK
Applicable Applications for mCherry Fluorescent Protein recombinant protein
Western Blot (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunofluorescence (IF)
Application Notes
Suitable for use as standard/positive control for SDS-PAGE and for Western Blot analysis of mCherry-transfected cells. Suitable for use in labeling proteins or antibodies. Also suitable for use in calibration of fluorometers and flow cytometers, and fluorescence microscope. mCherry protein can be microinjected into cells and tissues and is also ideal for fuison tag applications. Can be used for triple labeling with EGFP, CFP, YFP and other dyes. The 6xHis-Tag on the N-terminal can be used in Western Blot detection with 6xHis-Tag antibodies. The 6xHis-Tag can also be used in removal or purification of the mCherry protein. Other applications not tested.
Grade
Highly Purified
Endotoxin
< or =0.1ng/ug
Preparation and Storage
Lyophilized powder may be stored at -70 degree C. Stable for 12 months at -70 degree C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -70 degree C. Aliquot to avoid repeated freezing and thawing and store at -70 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for mCherry Fluorescent Protein recombinant protein
mCherry is the second generation monomeric red fluorescent protein that have improved brightness and photostability. The recombinant mCherry is expressed and purified from transformed E. coli using a method that ensures high purity and maximal fluorescence intensity.
The protein is a 28.8kD monomer with 256 amino acids, pI: 6.23. Ex.= 587 nm (540-590 nm); Em.= 610 nm (550-650 nm). The protein is engineered with 6xHis-tag on the N-terminus, which can be used for detection with anti-His-Tag antibody or protein purification/removal by using Ni++ beads.
The protein is a 28.8kD monomer with 256 amino acids, pI: 6.23. Ex.= 587 nm (540-590 nm); Em.= 610 nm (550-650 nm). The protein is engineered with 6xHis-tag on the N-terminus, which can be used for detection with anti-His-Tag antibody or protein purification/removal by using Ni++ beads.
Product Categories/Family for mCherry Fluorescent Protein recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
Molecular Weight
28.8kD
NCBI Official Full Name
mCherry fluorescent protein, partial
Similar Products
Product Notes
The mCherry Fluorescent Protein (Catalog #AAA635577) is a Recombinant Protein produced from E.Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's mCherry Fluorescent Protein can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunocytochemistry (ICC), Immunofluorescence (IF). Suitable for use as standard/positive control for SDS-PAGE and for Western Blot analysis of mCherry-transfected cells. Suitable for use in labeling proteins or antibodies. Also suitable for use in calibration of fluorometers and flow cytometers, and fluorescence microscope. mCherry protein can be microinjected into cells and tissues and is also ideal for fuison tag applications. Can be used for triple labeling with EGFP, CFP, YFP and other dyes. The 6xHis-Tag on the N-terminal can be used in Western Blot detection with 6xHis-Tag antibodies. The 6xHis-Tag can also be used in removal or purification of the mCherry protein. Other applications not tested. Researchers should empirically determine the suitability of the mCherry Fluorescent Protein for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGSSHHHHHH SSGLVPRGSH MVSKGEEDNM AIIKEFMRFK VHMEGSVNGH EFEIEGEGEG RPYEGTQTAK LKVTKGGPLP FAWDILSPQF MYGSKAYVKH PADIPDYLKL SFPEGFKWER VMNFEDGGVV TVTQDSSLQD GEFIYKVKLR GTNFPSDGPV MQKKTMGWEA SSERMYPEDG ALKGEIKQRL KLKDGGHYDA EVKTTYKAKK PVQLPGAYNV NIKLDITSHN EDYTIVEQYE RAEGRHSTGG MDELYK. It is sometimes possible for the material contained within the vial of "mCherry Fluorescent Protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
