SDS-PAGE
Yellow Fluorescent Protein Recombinant Protein
Yellow Fluorescent Protein
Applications
SDS-Page
Purity
>=97% by SDS-PAGE and HPLC
Synonyms
Yellow Fluorescent Protein; YFP; Recombinant YFP Protein; Yellow Fluoroscent Protein; Yellow Fluorescent Protein recombinant protein
Host
E.coli
Purity/Purification
>=97% by SDS-PAGE and HPLC
Form/Format
Freeze Dried
Sequence Length
243
Applicable Applications for Yellow Fluorescent Protein recombinant protein
SDS-PAGE; HPLC
Application Notes
The protein is suitable as control reagent for YFP expression studies or as labeling reagent. Applications include: Use as standards for SDS-PAGE, Western blot analysis of YFP transfected cells, label other proteins, calibration of fluorometers and flow cytometers, fluorescence microscope, or microinjection of YFP into cells and tissues, etc. The recombinant YFP is ideal for fusion tag applications and is perfect for triple labeling with EGFP (Cat.# MBS845247) and RFP (Cat.# MBS844904).
YFP AMINO ACID SEQUENCE
MRGSGSSGALLFHGKIPYVVEMEGNVDGHTFSIRGKGYGDASVGKVDAQFICTTGDVPVPW STLVTTLTYGAQCFAKYGPELKDFYKSCMPDGYVQERTITFEGDGNFKTRAEVTFENGSVYN RVKLNGQGFKKDGHVLGKNLEFNFTPHCLYIWGDQANHGLKSAFKICHEITGSKGDFIVADH TQMNTPIGGGPVHVPEYHHMSYHVKLSKDVTDHRDNMSLKETVRAVDCRKTYL
Reconstitution
Reconstitute with dH2O to 1 mg/ml
Endotoxin Level
<=0.1 ng/ug
Preparation and Storage
Store at -80°C for long term storage.
SDS-PAGE
SDS-PAGE
Related Product Information for Yellow Fluorescent Protein recombinant protein
The recombinant YFP (Yellow Fluorescent Protein) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal YFP fluorescence. Endotoxin has been removed, so the protein is suitable for in vivo injection or cell culture applications. The protein is a 26.4 kDa monomer with 238 amino acids, Ex./Em. = 525/538 nm, extinction coefficient 27765. (at 280 nm).
NCBI and Uniprot Product Information
NCBI GI #
NCBI Official Full Name
yellow fluorescent protein
Protein Family
Similar Products
Product Notes
The Yellow Fluorescent Protein (Catalog #AAA845430) is a Recombinant Protein produced from E.coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Yellow Fluorescent Protein can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE; HPLC. The protein is suitable as control reagent for YFP expression studies or as labeling reagent. Applications include: Use as standards for SDS-PAGE, Western blot analysis of YFP transfected cells, label other proteins, calibration of fluorometers and flow cytometers, fluorescence microscope, or microinjection of YFP into cells and tissues, etc. The recombinant YFP is ideal for fusion tag applications and is perfect for triple labeling with EGFP (Cat.# MBS845247) and RFP (Cat.# MBS844904). Researchers should empirically determine the suitability of the Yellow Fluorescent Protein for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Yellow Fluorescent Protein, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
