Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Melanocortin receptor 3 (MC3R) Recombinant Protein | MC3R recombinant protein

Recombinant Human Melanocortin receptor 3 (MC3R)

Gene Names
MC3R; MC3; OB20; OQTL; BMIQ9; MC3-R
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Melanocortin receptor 3 (MC3R); Recombinant Human Melanocortin receptor 3 (MC3R); MC3R recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-360aa; Full length protein
Sequence
MSIQKTYLEGDFVFPVSSSSFLRTLLEPQLGSALLTAMNASCCLPSVQPTLPNGSEHLQA PFFSNQSSSAFCEQVFIKPEVFLSLGIVSLLENILVILAVVRNGNLHSPMYFFLCSLAVA DMLVSVSNALETIMIAIVHSDYLTFEDQFIQHMDNIFDSMICISLVASICNLLAIAVDRY VTIFYALRYHSIMTVRKALTLIVAIWVCCGVCGVVFIVYSESKMVIVCLITMFFAMMLLM GTLYVHMFLFARLHVKRIAALPPADGVAPQQHSCMKGAVTITILLGVFIFCWAPFFLHLV LIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYAFRSLELRNTFREILCGCNGMNLG
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for MC3R recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,043 Da
NCBI Official Full Name
melanocortin receptor 3
NCBI Official Synonym Full Names
melanocortin 3 receptor
NCBI Official Symbol
MC3R
NCBI Official Synonym Symbols
MC3; OB20; OQTL; BMIQ9; MC3-R
NCBI Protein Information
melanocortin receptor 3
UniProt Protein Name
Melanocortin receptor 3
Protein Family
UniProt Gene Name
MC3R
UniProt Synonym Gene Names
MC3-R
UniProt Entry Name
MC3R_HUMAN

NCBI Description

This gene encodes a G-protein-coupled receptor for melanocyte-stimulating hormone and adrenocorticotropic hormone that is expressed in tissues other than the adrenal cortex and melanocytes. This gene maps to the same region as the locus for benign neonatal epilepsy. Mice deficient for this gene have increased fat mass despite decreased food intake, suggesting a role for this gene product in the regulation of energy homeostasis. Mutations in this gene are associated with a susceptibility to obesity in humans. [provided by RefSeq, Jul 2008]

Uniprot Description

MC3R: Receptor for MSH (alpha, beta and gamma) and ACTH. This receptor is mediated by G proteins which activate adenylate cyclase. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Receptor, GPCR; GPCR, family 1

Chromosomal Location of Human Ortholog: 20q13.2-q13.3

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: melanocortin receptor activity; melanocyte stimulating hormone receptor activity; neuropeptide binding; peptide hormone binding; protein binding

Biological Process: circadian regulation of gene expression; G-protein signaling, coupled to cAMP nucleotide second messenger; G-protein signaling, coupled to cyclic nucleotide second messenger; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); homoiothermy; locomotor rhythm; positive regulation of cAMP biosynthetic process; regulation of blood pressure; regulation of heart rate; sodium ion homeostasis

Disease: Body Mass Index Quantitative Trait Locus 9; Mycobacterium Tuberculosis, Susceptibility To

Research Articles on MC3R

Similar Products

Product Notes

The MC3R mc3r (Catalog #AAA7019945) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-360aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the MC3R mc3r for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSIQKTYLEG DFVFPVSSSS FLRTLLEPQL GSALLTAMNA SCCLPSVQPT LPNGSEHLQA PFFSNQSSSA FCEQVFIKPE VFLSLGIVSL LENILVILAV VRNGNLHSPM YFFLCSLAVA DMLVSVSNAL ETIMIAIVHS DYLTFEDQFI QHMDNIFDSM ICISLVASIC NLLAIAVDRY VTIFYALRYH SIMTVRKALT LIVAIWVCCG VCGVVFIVYS ESKMVIVCLI TMFFAMMLLM GTLYVHMFLF ARLHVKRIAA LPPADGVAPQ QHSCMKGAVT ITILLGVFIF CWAPFFLHLV LIITCPTNPY CICYTAHFNT YLVLIMCNSV IDPLIYAFRS LELRNTFREI LCGCNGMNLG. It is sometimes possible for the material contained within the vial of "Melanocortin receptor 3 (MC3R), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual