Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Melanocyte-stimulating hormone receptor (MC1R) Recombinant Protein | MC1R recombinant protein

Recombinant Horse Melanocyte-stimulating hormone receptor (MC1R)

Gene Names
MC1R; MSH-R
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Melanocyte-stimulating hormone receptor (MC1R); Recombinant Horse Melanocyte-stimulating hormone receptor (MC1R); Recombinant Melanocyte-stimulating hormone receptor (MC1R); Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R; MC1R recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-317
Sequence
MPLQGPQRRLLGSLNSTLPATPYLGLTTNQTEPPCLEVSIPDGLFLSLGLVSLVENVLVVTAIAKNRNLHSPMYYFICCLAVSDLLVSMSNVLEMAILLLLEAGVLATQASVLQQLDNIIDVLICGSMVSSLCFLGSIAVDRYISIFYALRYHSIMMLPRVWRAIVAIWVVSVLSSTLFIAYYNHTAVLLCLVTFFVAMLVLMAVLYVHMLARACQHARGIARLHKRQHPIHQGFGLKGAATLTILLGVFFLCWGPFFLHLSLLILCPQHPTCGCVFKNFKLFLTLILCSAIVDPLIYAFRSQELRKTLQEVLLCSW
Sequence Length
317
Species
Equus caballus (Horse)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,213 Da
NCBI Official Full Name
melanocyte-stimulating hormone receptor
NCBI Official Symbol
MC1R
NCBI Official Synonym Symbols
MSH-R
NCBI Protein Information
melanocyte-stimulating hormone receptor; MC1-R; melanocortin receptor 1
UniProt Protein Name
Melanocyte-stimulating hormone receptor
UniProt Gene Name
MC1R
UniProt Synonym Gene Names
MSH-R; MC1-R
UniProt Entry Name
MSHR_HORSE

Uniprot Description

Function: Receptor for MSH (alpha, beta) and ACTH. Does not seem to be active with gamma-MSH. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.

Subunit structure: Interacts with MGRN1, but does not undergo MGRN1-mediated ubiquitination; this interaction competes with GNAS-binding and thus inhibits agonist-induced cAMP production

By similarity.

Subcellular location: Cell membrane; Multi-pass membrane protein.

Sequence similarities: Belongs to the G-protein coupled receptor 1 family.

Similar Products

Product Notes

The MC1R mc1r (Catalog #AAA718104) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-317. The amino acid sequence is listed below: MPLQGPQRRL LGSLNSTLPA TPYLGLTTNQ TEPPCLEVSI PDGLFLSLGL VSLVENVLVV TAIAKNRNLH SPMYYFICCL AVSDLLVSMS NVLEMAILLL LEAGVLATQA SVLQQLDNII DVLICGSMVS SLCFLGSIAV DRYISIFYAL RYHSIMMLPR VWRAIVAIWV VSVLSSTLFI AYYNHTAVLL CLVTFFVAML VLMAVLYVHM LARACQHARG IARLHKRQHP IHQGFGLKGA ATLTILLGVF FLCWGPFFLH LSLLILCPQH PTCGCVFKNF KLFLTLILCS AIVDPLIYAF RSQELRKTLQ EVLLCSW. It is sometimes possible for the material contained within the vial of "Melanocyte-stimulating hormone receptor (MC1R), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.