Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

E3 ubiquitin-protein ligase MARCH8 (MARCH8) Recombinant Protein | MARCH8 recombinant protein

Recombinant Mouse E3 ubiquitin-protein ligase MARCH8 (MARCH8)

Gene Names
March8; Mir; MARCH-VIII; 1300017E09Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase MARCH8 (MARCH8); Recombinant Mouse E3 ubiquitin-protein ligase MARCH8 (MARCH8); MARCH8 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-286aa; full length protein
Sequence
MSMPLHQISAIPSQDAISARVYRSKTKDKEQNEKTLGHSMSHPSNISKAGSSPPSTTAPV SAFSRTSVTPSNQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCE LCKYEFIMETKLKPLRKWEKLQMTASERRKIMCSVTFHVIAITCVVWSLYVLIDRTAEEI KQGQVTGILEWPFWTKLVVVAIGFTGGLLFMYVQCKVYLQLWKRLKAYNRVIYVQNCPET SKKNIFEKSALTEPTLENKEGHGMCHSTTNSSCTEPEDTGAEIINV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for MARCH8 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,243 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase MARCH8 isoform 1
NCBI Official Synonym Full Names
membrane-associated ring finger (C3HC4) 8
NCBI Official Symbol
March8
NCBI Official Synonym Symbols
Mir; MARCH-VIII; 1300017E09Rik
NCBI Protein Information
E3 ubiquitin-protein ligase MARCH8
UniProt Protein Name
E3 ubiquitin-protein ligase MARCH8
UniProt Gene Name
March8
UniProt Synonym Gene Names
Mir; c-MIR; MARCH-VIII
UniProt Entry Name
MARH8_MOUSE

NCBI Description

The protein encoded by this gene is a member of the membrane-associated really interesting new gene-CH family of proteins. These proteins are E3 ubiquitin-protein ligases that modulate antigen presentation by downregulating major histocompatibility complex class II surface expression through endocytosis. The transcript is primarily expressed by dendritic cells and macrophages. Overexpression of this gene in antigen presenting cells results in immune defective phenotypes, including resistance to autoimmune disease onset. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]

Uniprot Description

MARCH8: E3 ubiquitin-protein ligase that mediates ubiquitination of CD86 and MHC class II proteins, such as HLA-DR alpha and beta, and promotes their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. May also promote ubiquitination and endocytosis of TFRC and FAS.

Protein type: Membrane protein, integral; EC 6.3.2.-; EC 6.3.2.19; Ubiquitin conjugating system; Membrane protein, multi-pass; Ubiquitin ligase; Ligase

Cellular Component: cytoplasmic vesicle; endosome; integral to membrane; lysosome; membrane

Molecular Function: coenzyme F420-0 gamma-glutamyl ligase activity; coenzyme F420-2 alpha-glutamyl ligase activity; ligase activity; metal ion binding; MHC class II protein binding; ribosomal S6-glutamic acid ligase activity; ubiquitin-protein ligase activity; UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate-D-alanyl-D-alanine ligase activity; zinc ion binding

Biological Process: adaptive immune response; antigen processing and presentation of peptide antigen via MHC class II; immune system process; negative regulation of MHC class II biosynthetic process; protein polyubiquitination; protein ubiquitination

Similar Products

Product Notes

The MARCH8 march8 (Catalog #AAA7006886) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-286aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the MARCH8 march8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSMPLHQISA IPSQDAISAR VYRSKTKDKE QNEKTLGHSM SHPSNISKAG SSPPSTTAPV SAFSRTSVTP SNQDICRICH CEGDDESPLI TPCHCTGSLH FVHQACLQQW IKSSDTRCCE LCKYEFIMET KLKPLRKWEK LQMTASERRK IMCSVTFHVI AITCVVWSLY VLIDRTAEEI KQGQVTGILE WPFWTKLVVV AIGFTGGLLF MYVQCKVYLQ LWKRLKAYNR VIYVQNCPET SKKNIFEKSA LTEPTLENKE GHGMCHSTTN SSCTEPEDTG AEIINV. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase MARCH8 (MARCH8), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.