Mitogen-activated protein kinase 1 (mapk1) Recombinant Protein | mapk1 recombinant protein

Recombinant Xenopus laevis Mitogen-activated protein kinase 1 (mapk1)

Cat. Num. AAA1073546

• Gene Names: mapk1.S; erk; erk2; ert1; mapk; mpk1; xp42; mapk1; mapk2; prkm1; prkm2; mapk1a; mapk1-a; mapk1-b; p42mapk
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Mitogen-activated protein kinase 1 (mapk1); Recombinant Xenopus laevis Mitogen-activated protein kinase 1 (mapk1); mapk1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-361, Full length protein
• Sequence: MAAAGAASNPGGGPEMVRGQAFDVGPRYINLAYIGEGAYGMVCSAHDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFKHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADPKALDLLDKMLTFNPHKRIEVEAALAHPYLEQYYDPSDEPVAEAPFKFEMELDDLPKETLKELIFEETARFQPGY
• Sequence Length: 361

• Species: Xenopus laevis (African clawed frog)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 148228736
• NCBI GeneID: 398985
• NCBI Accession #: NP_001083548.1
• NCBI GenBank Nucleotide #: NM_001090079.1
• UniProt Accession #: P26696; Q5D061
• Molecular Weight: 41,257 Da
• NCBI Official Full Name: mitogen-activated protein kinase 1
• NCBI Official Synonym Full Names: mitogen-activated protein kinase 1 S homeolog
• NCBI Official Symbol: mapk1.S
• NCBI Official Synonym Symbols: erk; erk2; ert1; mapk; mpk1; xp42; mapk1; mapk2; prkm1; prkm2; mapk1a; mapk1-a; mapk1-b; p42mapk
• NCBI Protein Information: mitogen-activated protein kinase 1
• UniProt Protein Name: Mitogen-activated protein kinase 1
• UniProt Gene Name: mapk1
• UniProt Synonym Gene Names: mpk1; MAP kinase 1; MAPK 1; MBP kinase

Uniprot Description

Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. Plays an important role in the MAPK/ERK cascade. Depending on the cellular context, this cascade mediates diverse biological functions such as cell growth, adhesion, survival and differentiation through the regulation of transcription, translation, cytoskeletal rearrangements. The MAPK/ERK cascade plays also a role in initiation and regulation of meiosis, mitosis, and postmitotic functions in differentiated cells by phosphorylating a number of transcription factors. Many of the substrates are localized in the nucleus, and seem to participate in the regulation of transcription upon stimulation. However, other substrates are found in the cytosol as well as in other cellular organelles, and those are responsible for processes such as translation, mitosis and apoptosis. Moreover, the MAPK/ERK cascade is also involved in the regulation of the endosomal dynamics, including lysosome processing and endosome cycling through the perinuclear recycling compartment (PNRC); as well as in the fragmentation of the Golgi apparatus during mitosis. Phosphorylates microtubule-associated protein 2 (MAP2), myelin basic protein (MBP) and Elk-1. Phosphorylates dual specificity protein phosphatase 1 (DUSP1) during meiosis, increasing its stability. Activated by M phase promoting factor (MPF). Plays a role in the spindle assembly checkpoint.