Interleukin-15 & Interleukin-15 Receptor Subunit alpha (IL15 & IL15RA) Active Protein | IL15/IL15RA active protein

Recombinant Human Interleukin-15 & Interleukin-15 Receptor Subunit alpha (IL15 & IL15RA)

Cat. Num. AAA7115064

• Gene Names: IL15RA; CD215
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Interleukin-15 & Interleukin-15 Receptor Subunit alpha (IL15 & IL15RA); Recombinant Human Interleukin-15 & Interleukin-15 Receptor Subunit alpha (IL15 & IL15RA); IL15RA&IL15; Interleukin-15; IL-15; IL15; IL-15 receptor subunit alpha; IL-15RA; IL-15R-alpha; interleukin-15 receptor subunit alpha; IL15/IL15RA active protein

• Host: Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.4
• Sequence Positions: 31-96aa & 49-162aa; Heterodimer
• Sequence: ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRD & NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGD ASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
• Sequence Length: 231

• Species: Human
• Tag: C-terminal FC-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined in a cell proliferation assay using CTLL-2 mouse cytotoxic T cells is less than 20 ng/ml.
• Classification: Cytokine
• Subdivision: Interleukin
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for IL15/IL15RA active protein

IL15RA is a high-affinity receptor for interleukin-15. Il15ra associates as a heterotrimer with the IL-2 receptor beta and gamma subunits to initiate signal transduction. It can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Il15ra is expressed in special cells including a wide variety of Tand B cells and non-lymphoid cells. IL-15 is a cytokine that regulates T cell and natural killer cell activation and proliferation. IL-15 binds to the alpha subunit of the IL-15RA with high affinity. IL-15 also binds to the beta and gamma chains of the IL-2 receptor, but not the alpha subunit of the IL2 receptor. IL-15 is structurally and functionally related to IL-2. Both cytokines share some subunits of receptors, allowing them to compete for and negatively regulate each other's activity. The number of CD8+ memory T cells is controlled by a balance between IL-15 and IL-2. Despite their many overlapping functional properties, IL-2 and IL-15 are, in fact, quite distinct players in the immune system. IL-15 is constitutively expressed by a wide variety of cell types and tissues, including monocytes, macrophages and DCs.

Product Categories/Family for IL15/IL15RA active protein

Cancer

NCBI and Uniprot Product Information

• NCBI GI #: 343780891
• NCBI GeneID: 3601
• NCBI Accession #: NP_001230468.1
• NCBI GenBank Nucleotide #: NM_001243539.1
• UniProt Accession #: Q13261; P40933
• Molecular Weight: 46.9 kDa
• NCBI Official Full Name: interleukin-15 receptor subunit alpha isoform 3
• NCBI Official Synonym Full Names: interleukin 15 receptor subunit alpha
• NCBI Official Symbol: IL15RA
• NCBI Official Synonym Symbols: CD215
• NCBI Protein Information: interleukin-15 receptor subunit alpha
• UniProt Protein Name: Interleukin-15 receptor subunit alpha
• UniProt Gene Name: IL15RA
• UniProt Synonym Gene Names: IL-15 receptor subunit alpha; IL-15R-alpha; IL-15RA; sIL-15 receptor subunit alpha; sIL-15R-alpha; sIL-15RA
• UniProt Entry Name: I15RA_HUMAN

NCBI Description

This gene encodes a cytokine receptor that specifically binds interleukin 15 (IL15) with high affinity. The receptors of IL15 and IL2 share two subunits, IL2R beta and IL2R gamma. This forms the basis of many overlapping biological activities of IL15 and IL2. The protein encoded by this gene is structurally related to IL2R alpha, an additional IL2-specific alpha subunit necessary for high affinity IL2 binding. Unlike IL2RA, IL15RA is capable of binding IL15 with high affinity independent of other subunits, which suggests distinct roles between IL15 and IL2. This receptor is reported to enhance cell proliferation and expression of apoptosis inhibitor BCL2L1/BCL2-XL and BCL2. Multiple alternatively spliced transcript variants of this gene have been reported.[provided by RefSeq, Apr 2010]

Uniprot Description

IL15RA: High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Expression of different isoforms may alter or interfere with signal transduction. Isoform 5, isoform 6, isoform 7 and isoform 8 do not bind IL15. Signal transduction involves STAT3, STAT5, STAT6, JAK2 and SYK. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, cytokine

Chromosomal Location of Human Ortholog: 10p15.1

Cellular Component: Golgi membrane; extracellular space; endoplasmic reticulum membrane; nuclear membrane; cytoplasmic vesicle membrane; integral to membrane

Molecular Function: hematopoietin/interferon-class (D200-domain) cytokine receptor activity; signal transducer activity; protein binding

Biological Process: cell proliferation; cytokine and chemokine mediated signaling pathway; signal transduction