UL16-Binding Protein 2 (ULBP2) Active Protein | ULBP2 active protein

Recombinant Human UL16-Binding Protein 2 (ULBP2), Partial

Cat. Num. AAA7115149

• Gene Names: ULBP2; N2DL2; RAET1H; RAET1L; NKG2DL2; ALCAN-alpha
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: UL16-Binding Protein 2 (ULBP2); Recombinant Human UL16-Binding Protein 2 (ULBP2); Partial; NKG2D Ligand 2; N2DL-2; NKG2DL2; ALCAN-Alpha; Retinoic Acid Early Transcript 1H; UL16-Binding Protein 2; ULBP2; N2DL2; RAET1H; ULBP2 active protein

• Host: Mammalian Cell
• Specificity: Expressed in various types of cancer cell lines and in the fetus, but not in normal tissues.
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.4
• Sequence Positions: 26-217aa; Partial
• Sequence: GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSS
• Sequence Length: 246

• Species: Human
• Tag: C-terminal FC-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by its ability to bind Human ULBP-2 in functional ELISA is less than 30 ug/ml.
• Subcellular Location: Cell Membrane, Lipid-Anchor, GPI-Anchor, Endoplasmic Reticulum, Secreted
• Protein Families: MHC Class I Family
• Classification: Other Recombinant Protein
• Pathway: Natural Killer Cell Mediated Cytotoxicity
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for ULBP2 active protein

Relevance: NKG2D Ligand 2 (N2DL2) is a member of a family of cell-surface proteins. N2DL2 function as ligands for human cytomegalovirus glycoprotein UL16. N2DL2 is anchored to the membrane via a GPI-linkage. N2DL2 is bind to human NKG2D, an activating receptor expressed on NK cells, NKT cells, T cells. Engagement of NKG2D results in the activation of cytolytic activity and cytokine production by these effects cells. The ULBPs are expressed on some tumor cells and have been implicated in tumor surveillance.

Function: Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity.

Product Categories/Family for ULBP2 active protein

Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 37182452
• NCBI GeneID: 80328
• UniProt Accession #: Q9BZM5
• Molecular Weight: 51.4 kDa
• NCBI Official Full Name: ULBP2
• NCBI Official Synonym Full Names: UL16 binding protein 2
• NCBI Official Symbol: ULBP2
• NCBI Official Synonym Symbols: N2DL2; RAET1H; RAET1L; NKG2DL2; ALCAN-alpha
• NCBI Protein Information: UL16-binding protein 2
• UniProt Protein Name: NKG2D ligand 2
• Protein Family: NKG2D ligand
• UniProt Gene Name: ULBP2
• UniProt Synonym Gene Names: N2DL2; RAET1H; N2DL-2; NKG2DL2
• UniProt Entry Name: N2DL2_HUMAN

NCBI Description

This gene encodes a major histocompatibility complex (MHC) class I-related molecule that binds to the NKG2D receptor on natural killer (NK) cells to trigger release of multiple cytokines and chemokines that in turn contribute to the recruitment and activation of NK cells. The encoded protein undergoes further processing to generate the mature protein that is either anchored to membrane via a glycosylphosphatidylinositol moiety, or secreted. Many malignant cells secrete the encoded protein to evade immunosurveillance by NK cells. This gene is located in a cluster of multiple MHC class I-related genes on chromosome 6. [provided by RefSeq, Jul 2015]