Tumor Necrosis Factor Receptor Superfamily Member 5 (CD40) Active Protein | CD40 active protein

Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 5 (CD40), Partial

Cat. Num. AAA7115115

• Gene Names: CD40; p50; Bp50; CDW40; TNFRSF5
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Tumor Necrosis Factor Receptor Superfamily Member 5 (CD40); Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 5 (CD40); Partial; Tumor Necrosis Factor Receptor Superfamily member 5; B-Cell Surface Antigen CD40; Bp50; CD40L Receptor; CDw40; CD40; TNFRSF5; CD40 active protein

• Host: Mammalian Cell
• Specificity: B-cells and in primary carcinomas.
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.4
• Sequence Positions: 21-193aa; Extracellular Domain
• Sequence: EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
• Sequence Length: 277

• Species: Human
• Tag: C-terminal FC-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by its ability to bind Human TNFSF5 in functional ELISA is less than 20 ug/ml.
• Subcellular Location: Isoform I: Cell Membrane, Single-Pass Type I Membrane Protein, SUBCELLULAR LOCATION: Isoform II: Secreted
• Classification: Drug Target
• Subdivision: Immune Checkpoint
• Pathway: NF-kappaB Signaling Pathway
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for CD40 active protein

Relevance: CD40 is a Type I Transmembrane Glycoprotein that belongs to the TNF Receptor Superfamily. CD40 is expressed in B cells, follicular dendritic cells, dendritic cells, activated monocytes, macrophages, endothelial cells, vascular smooth muscle cells, and several tumor cell lines. The extracellular domain of CD40 is characterized by Cysteine rich repeat regions. Interaction of CD40 with its ligand (CD40L) leads to aggregation of CD40 molecules, which in turn interact with cytoplasmic components to initiate signaling pathways. Several different TRAF proteins (adaptor proteins) have been identified to serves as mediators of the signal transduction. CD40 plays an essential role in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation.

Function: Receptor for TNFSF5/CD40LG. Transduces TRAF6- and MAP3K8-mediated signals that activate ERK in macrophages and B cells, leading to induction of immunoglobulin secretion.

Product Categories/Family for CD40 active protein

Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 4507581
• NCBI GeneID: 958
• NCBI Accession #: NP_001241.1
• NCBI GenBank Nucleotide #: NM_001250.5
• UniProt Accession #: P25942
• Molecular Weight: 46.3 kDa
• NCBI Official Full Name: tumor necrosis factor receptor superfamily member 5 isoform 1
• NCBI Official Synonym Full Names: CD40 molecule
• NCBI Official Symbol: CD40
• NCBI Official Synonym Symbols: p50; Bp50; CDW40; TNFRSF5
• NCBI Protein Information: tumor necrosis factor receptor superfamily member 5
• UniProt Protein Name: Tumor necrosis factor receptor superfamily member 5
• Protein Family: Tumor necrosis factor receptor superfamily
• UniProt Gene Name: CD40
• UniProt Synonym Gene Names: TNFRSF5
• UniProt Entry Name: TNR5_HUMAN

NCBI Description

This gene is a member of the TNF-receptor superfamily. The encoded protein is a receptor on antigen-presenting cells of the immune system and is essential for mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Mutations affecting this gene are the cause of autosomal recessive hyper-IgM immunodeficiency type 3 (HIGM3). Multiple alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Nov 2014]

Uniprot Description

CD40: a member of the TNF-receptor superfamily. This receptor for CD40L mediates a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. Defects in CD40 are the cause of hyper-IgM immunodeficiency type 3 (HIGM3). HIGM3 is an autosomal recessive disorder which includes an inability of B cells to undergo isotype switching, one of the final differentiation steps in the humoral immune system, an inability to mount an antibody-specific immune response, and a lack of germinal center formation. Two alternatively spliced isoforms have been reported. Isoform I is a type I membrane protein; isoform II is secreted.

Protein type: Receptor, cytokine; Membrane protein, integral

Chromosomal Location of Human Ortholog: 20q12-q13.2

Cellular Component: extracellular space; cell surface; intracellular membrane-bound organelle; integral to plasma membrane; cytoplasm; plasma membrane; external side of plasma membrane

Molecular Function: protein binding; signal transducer activity; enzyme binding; ubiquitin protein ligase binding; receptor activity; antigen binding

Biological Process: B cell proliferation; positive regulation of isotype switching to IgG isotypes; platelet activation; regulation of immune response; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of interleukin-12 production; immune response-regulating cell surface receptor signaling pathway; activation of NF-kappaB transcription factor; cellular calcium ion homeostasis; positive regulation of MAP kinase activity; positive regulation of tyrosine phosphorylation of Stat1 protein; protein kinase B signaling cascade; positive regulation of B cell proliferation; protein complex assembly; positive regulation of transcription from RNA polymerase II promoter; positive regulation of protein amino acid phosphorylation; inflammatory response; regulation of immunoglobulin secretion; defense response to virus

Disease: Immunodeficiency With Hyper-igm, Type 3