Tumor Necrosis Factor Receptor Superfamily Member 4 (TNFRSF4) Active Protein | TNFRSF4 active protein

Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 4 (TNFRSF4), Partial

Cat. Num. AAA7115122

• Gene Names: TNFRSF4; OX40; ACT35; CD134; IMD16; TXGP1L
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Tumor Necrosis Factor Receptor Superfamily Member 4 (TNFRSF4); Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 4 (TNFRSF4); Partial; Tumor necrosis factor receptor superfamily member 4; ACT35 antigen; OX40L receptor; TAX transcriptionally-activated glycoprotein 1 receptor; TNFRSF4; OX40; CD134; Txgp1; TNFRSF4 active protein

• Host: Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 1xPBS, pH 7.4
• Sequence Positions: 29-216aa; Partial
• Sequence: LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA
• Sequence Length: 277

• Species: Human
• Tag: C-terminal FC-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by its ability to bind Human TNFSF4 in functional ELISA is less than 10 ug/ml.
• Subcellular Location: Membrane, Single-Pass Type I Membrane Protein
• Classification: Drug Target
• Subdivision: Immune Checkpoint
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for TNFRSF4 active protein

Relevance: OX40, also termed CD134 and TNFRSF4, is a T cell co-stimulatory molecule of the TNF receptor superfamily which plays a key role in the survival and homeostasis of effector and memory T cells. OX40 is expressed on CD4+ and CD8+ T cells upon engagement of the TCR by antigen presenting cells along with co-stimulation by CD40-CD40 Ligand and CD28-B7. The interaction between OX40 and OX40 ligand (OX40L) will occur when activated T cells bind to professional antigen-presenting cells (APCs). The T-cell functions, including cytokine production, expansion, and survival, are then enhanced by the OX40 costimulatory signals. OX40 signals are critical for controlling the function and differentiation of Foxp3+ regulatory T cells. OX40-OX40L interaction regulates T-cell tolerance, peripheral T-cell homeostasis, and T-cell-mediated inflammatory diseases.

Function: Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity.

Product Categories/Family for TNFRSF4 active protein

Cancer

NCBI and Uniprot Product Information

• NCBI GI #: 1171933
• NCBI GeneID: 7293
• UniProt Accession #: P43489
• Molecular Weight: 46.8 kDa
• NCBI Official Full Name: Tumor necrosis factor receptor superfamily member 4
• NCBI Official Synonym Full Names: TNF receptor superfamily member 4
• NCBI Official Symbol: TNFRSF4
• NCBI Official Synonym Symbols: OX40; ACT35; CD134; IMD16; TXGP1L
• NCBI Protein Information: tumor necrosis factor receptor superfamily member 4
• UniProt Protein Name: Tumor necrosis factor receptor superfamily member 4
• Protein Family: Tumor necrosis factor receptor superfamily
• UniProt Gene Name: TNFRSF4
• UniProt Synonym Gene Names: TXGP1L
• UniProt Entry Name: TNR4_HUMAN

NCBI Description

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB through its interaction with adaptor proteins TRAF2 and TRAF5. Knockout studies in mice suggested that this receptor promotes the expression of apoptosis inhibitors BCL2 and BCL2lL1/BCL2-XL, and thus suppresses apoptosis. The knockout studies also suggested the roles of this receptor in CD4+ T cell response, as well as in T cell-dependent B cell proliferation and differentiation. [provided by RefSeq, Jul 2008]

Uniprot Description

TNFRSF4: Receptor for TNFSF4/OX40L/GP34.

Protein type: Apoptosis; Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p36

Cellular Component: cell surface; integral to plasma membrane; external side of plasma membrane

Molecular Function: tumor necrosis factor receptor activity

Biological Process: T cell proliferation; regulation of apoptosis; tumor necrosis factor-mediated signaling pathway; negative regulation of transcription factor activity; negative regulation of cytokine secretion; positive regulation of B cell proliferation; cellular defense response; immune response; positive regulation of immunoglobulin secretion; negative regulation of transcription, DNA-dependent; inflammatory response; regulation of protein kinase activity

Disease: Immunodeficiency 16