Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Tumor Necrosis Factor Receptor Superfamily Member 10C (TNFRSF10C) Active Protein | TNFRSF10C active protein

Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 10C (TNFRSF10C), Partial

Gene Names
TNFRSF10C; LIT; DCR1; TRID; CD263; TRAILR3; TRAIL-R3; DCR1-TNFR
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tumor Necrosis Factor Receptor Superfamily Member 10C (TNFRSF10C); Recombinant Human Tumor Necrosis Factor Receptor Superfamily Member 10C (TNFRSF10C); Partial; Tumor Necrosis Factor Receptor Superfamily Member 10C; Antagonist Decoy Receptor for TRAIL/Apo-2L; Decoy TRAIL Receptor Without Death Domain; Decoy Receptor 1; DcR1; Lymphocyte Inhibitor of TRAIL; TNF-Related Apoptosis-Inducing Ligand Receptor 3; TRAIL Receptor 3; TRAIL-R3; TRAIL Receptor Without an Intracellular Domain; CD263; TNFRSF10C; DCR1; LIT; TRAILR3; TRID; TNFRSF10C active protein
Ordering
For Research Use Only!
Host
Mammalian Cell
Specificity
Higher expression in normal tissues than in tumor cell lines. Highly expressed in peripheral blood lymphocytes, spleen, skeletal muscle, placenta, lung and heart.
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.4
Sequence Positions
26-221aa; Partial
Sequence
ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPA
Sequence Length
259
Species
Human
Tag
C-terminal 6xHis-FC-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L-929 mouse fibroblast cells treated with TRAIL is typically 450 ng/mL.
Subcellular Location
Cell Membrane, Lipid-Anchor, GPI-Anchor
Classification
Cytokine
Subdivision
Tumor Necrosis Factor
Pathway
Apoptosis
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for TNFRSF10C active protein
Relevance: Tumor Necrosis Factor Receptor Superfamily Member 10C (TNFRSF10C) is a glycosyl-phosphatidylinositol-linked membrane protein which binds TRAIL with high affinity. TNFRSF10C has the TRAIL-binding extracellular cysteine-rich domains, lacks the intracellular signaling domain. As a result, binding of TRAIL to TRAIL R3 doesn't transduce an apoptosis signal. The expression of TRAIL R3 gene has been shown to protect cells bearing TRAIL R1 and/or TRAIL R2 from TRAIL-induced apoptosis.

Function: Receptor for the cytotoxic ligand TRAIL. Lacks a cytoplasmic death domain and hence is not capable of inducing apoptosis. May protect cells against TRAIL mediated apoptosis by competing with TRAIL-R1 and R2 for binding to the ligand.
Product Categories/Family for TNFRSF10C active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
48.7 kDa
NCBI Official Full Name
Tumor necrosis factor receptor superfamily member 10C
NCBI Official Synonym Full Names
TNF receptor superfamily member 10c
NCBI Official Symbol
TNFRSF10C
NCBI Official Synonym Symbols
LIT; DCR1; TRID; CD263; TRAILR3; TRAIL-R3; DCR1-TNFR
NCBI Protein Information
tumor necrosis factor receptor superfamily member 10C
UniProt Protein Name
Tumor necrosis factor receptor superfamily member 10C
UniProt Gene Name
TNFRSF10C
UniProt Synonym Gene Names
DCR1; LIT; TRAILR3; TRID; DcR1; TRAIL receptor 3; TRAIL-R3
UniProt Entry Name
TR10C_HUMAN

NCBI Description

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain and a transmembrane domain, but no cytoplasmic death domain. This receptor is not capable of inducing apoptosis, and is thought to function as an antagonistic receptor that protects cells from TRAIL-induced apoptosis. This gene was found to be a p53-regulated DNA damage-inducible gene. The expression of this gene was detected in many normal tissues but not in most cancer cell lines, which may explain the specific sensitivity of cancer cells to the apoptosis-inducing activity of TRAIL. [provided by RefSeq, Jul 2008]

Uniprot Description

TRAIL-R3: Receptor for the cytotoxic ligand TRAIL. Lacks a cytoplasmic death domain and hence is not capable of inducing apoptosis. May protect cells against TRAIL mediated apoptosis by competing with TRAIL-R1 and R2 for binding to the ligand. Higher expression in normal tissues than in tumor cell lines. Highly expressed in peripheral blood lymphocytes, spleen, skeletal muscle, placenta, lung and heart.

Protein type: Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 8p22-p21

Cellular Component: integral to plasma membrane

Molecular Function: transmembrane receptor activity; TRAIL binding

Biological Process: apoptosis; signal transduction

Research Articles on TNFRSF10C

Similar Products

Product Notes

The TNFRSF10C tnfrsf10c (Catalog #AAA7115095) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-221aa; Partial. The amino acid sequence is listed below: ATTARQEEVP QQTVAPQQQR HSFKGEECPA GSHRSEHTGA CNPCTEGVDY TNASNNEPSC FPCTVCKSDQ KHKSSCTMTR DTVCQCKEGT FRNENSPEMC RKCSRCPSGE VQVSNCTSWD DIQCVEEFGA NATVETPAAE ETMNTSPGTP APAAEETMNT SPGTPAPAAE ETMTTSPGTP APAAEETMTT SPGTPA. It is sometimes possible for the material contained within the vial of "Tumor Necrosis Factor Receptor Superfamily Member 10C (TNFRSF10C), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.