Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Tumor necrosis factor ligand superfamily member 8 (TNFSF8) Active Protein | TNFSF8 active protein

Recombinant Human Tumor necrosis factor ligand superfamily member 8 (TNFSF8), partial (Active)

Gene Names
TNFSF8; CD153; CD30L; CD30LG
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tumor necrosis factor ligand superfamily member 8 (TNFSF8); Recombinant Human Tumor necrosis factor ligand superfamily member 8 (TNFSF8); partial (Active); Recombinant Human Tumor necrosis factor ligand superfamily member 8 (TNFSF8) (His tagged); Tumor necrosis factor ligand superfamily member 8; CD30 ligand; CD30-L; CD_antigen= CD153; TNFSF8 active protein
Ordering
For Research Use Only!
Host
Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
63-234aa; Partial
Sequence
QRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
Species
Homo sapiens (Human)
Protein Information
Extracellular domain
Activity
Measured by its binding ability in a functional ELISA. Immobilized CD30 (MBS7112509) at 5 ug/ml can bind human CD30L, the EC50 is 4.169-6.360 ng/ml.
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
944
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,017 Da
NCBI Official Full Name
tumor necrosis factor ligand superfamily member 8 isoform 1
NCBI Official Synonym Full Names
tumor necrosis factor (ligand) superfamily, member 8
NCBI Official Symbol
TNFSF8
NCBI Official Synonym Symbols
CD153; CD30L; CD30LG
NCBI Protein Information
tumor necrosis factor ligand superfamily member 8; CD30-L; CD30 ligand; CD153 antigen; CD30 antigen ligand
UniProt Protein Name
Tumor necrosis factor ligand superfamily member 8
UniProt Gene Name
TNFSF8
UniProt Synonym Gene Names
CD30L; CD30LG; CD30-L
UniProt Entry Name
TNFL8_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF8/CD30, which is a cell surface antigen and a marker for Hodgkin lymphoma and related hematologic malignancies. The engagement of this cytokine expressed on B cell surface plays an inhibitory role in modulating Ig class switch. This cytokine was shown to enhance cell proliferation of some lymphoma cell lines, while to induce cell death and reduce cell proliferation of other lymphoma cell lines. The pleiotropic biologic activities of this cytokine on different CD30+ lymphoma cell lines may play a pathophysiologic role in Hodgkin's and some non-Hodgkin's lymphomas. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]

Uniprot Description

Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells.

Research Articles on TNFSF8

Similar Products

Product Notes

The TNFSF8 tnfsf8 (Catalog #AAA966571) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 63-234aa; Partial. The amino acid sequence is listed below: QRTDSIPNSP DNVPLKGGNC SEDLLCILKR APFKKSWAYL QVAKHLNKTK LSWNKDGILH GVRYQDGNLV IQFPGLYFII CQLQFLVQCP NNSVDLKLEL LINKHIKKQA LVTVCESGMQ TKHVYQNLSQ FLLDYLQVNT TISVNVDTFQ YIDTSTFPLE NVLSIFLYSN SD. It is sometimes possible for the material contained within the vial of "Tumor necrosis factor ligand superfamily member 8 (TNFSF8), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.