Tumor Necrosis Factor Ligand Superfamily Member 11 (Tnfsf11) Active Protein | Tnfsf11 active protein

Recombinant Mouse Tumor Necrosis Factor Ligand Superfamily Member 11 (Tnfsf11), Partial

Cat. Num. AAA7115099

• Gene Names: Tnfsf11; ODF; OPGL; RANKL; Ly109l; Trance
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Tumor Necrosis Factor Ligand Superfamily Member 11 (Tnfsf11); Recombinant Mouse Tumor Necrosis Factor Ligand Superfamily Member 11 (Tnfsf11); Partial; Tumor necrosis factor ligand superfamily member 11; Tnfsf11; Osteoclast differentiation factor; ODF; Osteoprotegerin ligand; OPGL; Receptor activator of nuclear factor kappa-B ligand; RANKL; TNF-related activation-induced cytokine; TRANCE; CD254; Tnfsf11 active protein

• Host: Mammalian Cell
• Specificity: Highly expressed in thymus and lymph nodes, but not in non-lymphoid tissues and is abundantly expressed in T-cells but not in B-cells. A high level expression is also seen in the trabecular bone and lung.
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.4
• Sequence Positions: 73-316aa; Partial
• Sequence: AQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID
• Sequence Length: 316

• Species: Mouse
• Tag: N-terminal 6xHis-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by its ability to bind Human TNFRSF11B in functional ELISA is less than 10 ug/ml.
• Subcellular Location: Isoform 1: Cell Membrane, Single-Pass Type II Membrane Protein, SUBCELLULAR LOCATION: Isoform 2: Cell Membrane, Single-Pass Type II Membrane Protein, SUBCELLULAR LOCATION: Isoform 3: Cytoplasm, SUBCELLULAR LOCATION: Tumor necrosis factor ligand superfamily member 11, soluble form: Secreted
• Protein Families: Tumor Necrosis Factor Family
• Classification: Cytokine
• Subdivision: Tumor Necrosis Factor
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for Tnfsf11 active protein

Relevance: Mouse tumor necrosis factor ligand superfamily member 11(Tnfsf11) is a member of the tumor necrosis factor (TNF) cytokine family. Tnfsf11 is widely expressed in cells including T cells and T cell rich organs, such as thymus and lymph nodes. This cytokine can bind to TNFRSF11B/OPG andTNFRSF11A/RANK. Tnfsf11 is involved in a number of fundamental biological processes such as acting as regulator of interactions between T-cells and dendritic cells, the regulation of the T-cell-dependent immune response and enhancing bone-resorption in humoral hypercalcemia of malignancy. It augments the ability of dendritic cells to stimulate naive T-cell proliferation.

Function: Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy (By similarity). Induces osteoclastogenesis by activating multiple signaling pathways in osteoclast precursor cells, chief among which is induction of long lasting oscillations in the intracellular concentration of Ca (2+) resulting in the activation of NFATC1, which translocates to the nucleus and induces osteoclast-specific gene transcription to allow differentiation of osteoclasts.

Product Categories/Family for Tnfsf11 active protein

Cancer

NCBI and Uniprot Product Information

• NCBI GI #: 114842415
• NCBI GeneID: 21943
• NCBI Accession #: NP_035743.2
• NCBI GenBank Nucleotide #: NM_011613.3
• UniProt Accession #: O35235
• Molecular Weight: 28.5 kDa
• NCBI Official Full Name: tumor necrosis factor ligand superfamily member 11
• NCBI Official Synonym Full Names: tumor necrosis factor (ligand) superfamily, member 11
• NCBI Official Symbol: Tnfsf11
• NCBI Official Synonym Symbols: ODF; OPGL; RANKL; Ly109l; Trance
• NCBI Protein Information: tumor necrosis factor ligand superfamily member 11
• UniProt Protein Name: Tumor necrosis factor ligand superfamily member 11
• Protein Family: Tumor necrosis factor ligand superfamily
• UniProt Gene Name: Tnfsf11
• UniProt Synonym Gene Names: Opgl; Rankl; Trance; ODF; OPGL; RANKL; TRANCE
• UniProt Entry Name: TNF11_MOUSE

Uniprot Description

TNFSF11: Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy. Homotrimer. Up-regulated by T-cell receptor stimulation. Highest in the peripheral lymph nodes, weak in spleen, peripheral blood Leukocytes, bone marrow, heart, placenta, skeletal muscle, stomach and thyroid. Belongs to the tumor necrosis factor family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Cellular Component: extracellular space; membrane; cytoplasm; extracellular region; integral to membrane; plasma membrane; intracellular

Molecular Function: protein binding; cytokine activity; tumor necrosis factor receptor superfamily binding; tumor necrosis factor receptor binding

Biological Process: ossification; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of osteoclast differentiation; multicellular organismal development; cytokine and chemokine mediated signaling pathway; positive regulation of JNK cascade; mammary gland epithelial cell proliferation; osteoclast differentiation; lymph node development; activation of JNK activity; positive regulation of corticotropin-releasing hormone secretion; activation of NF-kappaB transcription factor; positive regulation of homotypic cell-cell adhesion; calcium ion homeostasis; positive regulation of protein kinase B signaling cascade; monocyte chemotaxis; positive regulation of MAP kinase activity; organ morphogenesis; regulation of osteoclast differentiation; tumor necrosis factor-mediated signaling pathway; positive regulation of bone resorption; positive regulation of transcription from RNA polymerase II promoter; immune response; positive regulation of transcription factor activity; positive regulation of T cell activation; cell differentiation; positive regulation of phosphorylation; protein homooligomerization; bone resorption