NKG2-D Type II Integral Membrane (KLRK1) Active Protein | KLRK1 active protein

Recombinant Human NKG2-D Type II Integral Membrane Protein (KLRK1), Partial

Cat. Num. AAA7115157

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: NKG2-D Type II Integral Membrane (KLRK1); Recombinant Human NKG2-D Type II Integral Membrane Protein (KLRK1); Partial; CD314; KLRK1; CD314 antigen; Killer cell lectin-like receptor subfamily K member 1; killer cell lectin-like receptor subfamily K; member 1; KLR; NK cell receptor D; NKG2-D; NKG2-D type II integral membrane protein; NKG2-D-activating NK receptor; KLRK1 active protein

• Host: Mammalian Cell
• Specificity: Expressed in natural killer (NK) cells, CD8(+) alpha-beta and gamma-delta T-cells. Expressed on essentially all CD56+CD3- NK cells from freshly isolated PBMC. Expressed in interferon-producing killer dendritic cells (IKDCs).
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 1xPBS, pH 7.4
• Sequence Positions: 78-216aa; Partial
• Sequence: FLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
• Sequence Length: 216

• Species: Human
• Tag: N-terminal 6xHis-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by its ability to bind its antibody in a functional ELISA is less than 10 ug/ml.
• Subcellular Location: Cell Membrane, Single-Pass Type II Membrane Protein
• Classification: Other Recombinant Protein
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for KLRK1 active protein

Relevance: NKG2-D type II integral membrane protein (NKG2D) is a type II transmembrane glycoprotein which belongs to the CD94/NKG2 family. NKG2D is expressed on natural killer (NK) cells, CD8+ alpha-beta and gamma-delta T-cells. As an activating and costimulatory receptor, it involved in immunosurveillance upon binding to various cellular stress-inducible ligands displayed at the surface of autologous tumor cells and virus-infected cells. It provides both stimulatory and costimulatory innate immune responses on activated killer (NK) cells, leading to cytotoxic activity. It stimulates perforin-mediated elimination of ligand-expressing tumor cells. Signaling involves calcium influx, culminating in the expression of TNF-alpha. NKG2D participates in NK cell-mediated bone marrow graft rejection and survival of NK cells. It Binds to ligands belonging to various subfamilies of MHC class I-related glycoproteins including MICA, MICB, RAET1E, RAET1G, ULBP1, ULBP2, ULBP3 (ULBP2>ULBP1>ULBP3) and ULBP4.

Function: Function as an activating and costimulatory receptor involved in immunosurveillance upon binding to various cellular stress-inducible ligands displayed at the surface of autologous tumor cells and virus-infected cells. Provides both stimulatory and costimulatory innate immune responses on activated killer (NK) cells, leading to cytotoxic activity. Acts as a costimulatory receptor for T-cell receptor (TCR) in CD8(+) T-cell-mediated adaptive immune responses by amplifying T-cell activation. Stimulates perforin-mediated elimination of ligand-expressing tumor cells. Signaling involves calcium influx, culminating in the expression of TNF-alpha. Participates in NK cell-mediated bone marrow graft rejection. May play a regulatory role in differentiation and survival of NK cells. Binds to ligands belonging to various subfamilies of MHC class I-related glycoproteins including MICA, MICB, RAET1E, RAET1G, RAET1L/ULBP6, ULBP1, ULBP2, ULBP3 (ULBP2>ULBP1>ULBP3) and ULBP4.

Product Categories/Family for KLRK1 active protein

Immunology

NCBI and Uniprot Product Information

• NCBI GI #: 315221164
• NCBI GeneID: 100528032
• NCBI Accession #: NP_001186734.1
• NCBI GenBank Nucleotide #: NM_001199805.1
• UniProt Accession #: P26718
• Molecular Weight: 16.9 kDa
• NCBI Official Full Name: NKG2-D type II integral membrane protein
• NCBI Official Synonym Full Names: KLRC4-KLRK1 readthrough
• NCBI Official Symbol: KLRC4-KLRK1
• NCBI Protein Information: NKG2-D type II integral membrane protein
• UniProt Protein Name: NKG2-D type II integral membrane protein
• Protein Family: NKG2-D type II integral membrane protein
• UniProt Gene Name: KLRK1
• UniProt Synonym Gene Names: D12S2489E; NKG2D
• UniProt Entry Name: NKG2D_HUMAN

NCBI Description

This locus represents naturally occurring read-through transcription between the neighboring KLRC4 (killer cell lectin-like receptor subfamily C, member 4) and KLRK1 (killer cell lectin-like receptor subfamily K, member 1) genes on chromosome 12. The read-through transcript includes an alternate 5' exon and lacks a significant portion of the KLRC4 coding sequence, including the start codon, and it thus encodes the KLRK1 protein. [provided by RefSeq, Dec 2010]

Uniprot Description

KLRK1: Receptor for MICA, MICB, ULBP1, ULBP2, ULBP3 (ULBP2>ULBP1>ULBP3) and ULBP4. Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells. Involved in the immune surveillance exerted by T- and B-lymphocytes. 1 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell surface; Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 12p13.2-p12.3

Cellular Component: cell surface; integral to plasma membrane; plasma membrane; integral to membrane

Molecular Function: protein binding; receptor activity; carbohydrate binding

Biological Process: regulation of immune response; T cell costimulation; natural killer cell activation; innate immune response; cell differentiation; positive regulation of natural killer cell mediated cytotoxicity; signal transduction