Immunoglobulin Heavy Constant gamma 1 (IGHG1) Active Protein | IGHG1 active protein

Recombinant Human Immunoglobulin Heavy Constant gamma 1 (IGHG1), Partial

Cat. Num. AAA7115150

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Immunoglobulin Heavy Constant gamma 1 (IGHG1); Recombinant Human Immunoglobulin Heavy Constant gamma 1 (IGHG1); Partial; g gamma-1 chain C region; IGHG1; IGHG1 active protein

• Host: Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.4
• Sequence Positions: 104-330aa; Partial
• Sequence: DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Sequence Length: 330

• Species: Human
• Tag: Tag-Free
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by its ability to bind Human FCGR3A in functional ELISA is less than 10 ug/ml.
• Subcellular Location: Secreted, Cell Membrane
• Classification: Other Recombinant Protein
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for IGHG1 active protein

Relevance: As a monomeric immunoglobulin that is predominately involved in the secondary antibody response and the only isotype that can pass through the human placenta, Immunoglobulin G (IgG) is synthesized and secreted by plasma B cells, and constitutes 75% of serum immunoglobulins in humans. IgG antibodies protect the body against the pathogens by agglutination and immobilization, complement activation, toxin neutralization, as well as the antibody-dependent cell-mediated cytotoxicity (ADCC). IgG tetramer contains two heavy chains (50 kDa) and two light chains (25 kDa) linked by disulfide bonds, that is the two identical halves form the Y-like shape. IgG is digested by pepsin proteolysis into Fab fragment (antigen-binding fragment) and Fc fragment ("crystallizable" fragment). IgG1 is most abundant in serum among the four IgG subclasses (IgG1, 2, 3 and 4) and binds to Fc receptors (FcgammaR) on phagocytic cells with high affinity.

Function: Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens.

Product Categories/Family for IGHG1 active protein

Cancer

NCBI and Uniprot Product Information

• NCBI GI #: 121039
• NCBI GeneID: 3500
• UniProt Accession #: P01857
• Molecular Weight: 25.9 kDa
• NCBI Official Full Name: Immunoglobulin heavy constant gamma 1
• NCBI Official Synonym Full Names: immunoglobulin heavy constant gamma 1 (G1m marker)
• NCBI Official Symbol: IGHG1
• UniProt Protein Name: Ig gamma-1 chain C region
• Protein Family: Ig gamma-1 chain C region
• UniProt Gene Name: IGHG1
• UniProt Entry Name: IGHG1_HUMAN

Uniprot Description

IGHG1: Defects in IGHG1 are a cause of multiple myeloma (MM). MM is a malignant tumor of plasma cells usually arising in the bone marrow and characterized by diffuse involvement of the skeletal system, hyperglobulinemia, Bence-Jones proteinuria and anemia. Complications of multiple myeloma are bone pain, hypercalcemia, renal failure and spinal cord compression. The aberrant antibodies that are produced lead to impaired humoral immunity and patients have a high prevalence of infection. Amyloidosis may develop in some patients. Multiple myeloma is part of a spectrum of diseases ranging from monoclonal gammopathy of unknown significance (MGUS) to plasma cell leukemia. A chromosomal aberration involving IGHG1 is found in multiple myeloma. Translocation t(11;14)(q13;q32) with the IgH locus. Translocation t(11;14)(q13;q32) with CCND1; translocation t(4;14)(p16.3;q32.3) with FGFR3; translocation t(6;14)(p25;q32) with IRF4.

Protein type: Immunoglobulin superfamily

Chromosomal Location of Human Ortholog: 14q32.33

Cellular Component: extracellular space; extracellular region

Molecular Function: protein binding; antigen binding

Biological Process: innate immune response; complement activation, classical pathway; complement activation

Disease: Myeloma, Multiple