Ephrin Type-A Receptor 8 (EPHA8) Active Protein | EPHA8 active protein

Recombinant Human Ephrin Type-A Receptor 8 (EPHA8), Partial

Cat. Num. AAA7115155

• Gene Names: EPHA8; EEK; EK3; HEK3
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Ephrin Type-A Receptor 8 (EPHA8); Recombinant Human Ephrin Type-A Receptor 8 (EPHA8); Partial; Ephrin type-A receptor 8; EEK; HEK3; KIAA1459; EPHA8; Tyrosine-protein kinase receptor EEK; hEK3; EK3; EPH-like kinase 3; EPH- and ELK-related kinase; EPHA8 active protein

• Host: Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 20 mM PB, 150 mM NaCl, pH 7.4
• Sequence Positions: 28-495aa; Partial
• Sequence: ARGEVNLLDTSTIHGDWGWLTYPAHGWDSINEVDESFQPIHTYQVCNVMSPNQNNWLRTSWVPRDGARRVYAEIKFTLRDCNSMPGVLGTCKETFNLYYLESDRDLGASTQESQFLKIDTIAADESFTGADLGVRRLKLNTEVRSVGPLSKRGFYLAFQDIGACLAILSLRIYYKKCPAMVRNLAAFSEAVTGADSSSLVEVRGQCVRHSEERDTPKMYCSAEGEWLVPIGKCVCSAGYEERRDACVACELGFYKSAPGDQLCARCPPHSHSAAPAAQACHCDLSYYRAALDPPSSACTRPPSAPVNLISSVNGTSVTLEWAPPLDPGGRSDITYNAVCRRCPWALSRCEACGSGTRFVPQQTSLVQASLLVANLLAHMNYSFWIEAVNGVSDLSPEPRRAAVVNITTNQAAPSQVVVIRQERAGQTSVSLLWQEPEQPNGIILEYEIKYYEKDKEMQSYSTLKAVTT
• Sequence Length: 495

• Species: Human
• Tag: C-terminal FC-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by its ability to bind Mouse Ephrin-A5 in functional ELISA is less than 40 ug/ml.
• Subcellular Location: Cell Membrane, Single-Pass Type I Membrane Protein, Cell Projection, Early Endosome Membrane
• Protein Families: Protein Kinase Superfamily, Tyr protein Kinase Family, Ephrin Receptor Subfamily
• Classification: Other Recombinant Protein
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for EPHA8 active protein

Relevance: Ephrin type-A receptor 8 (EPHA8) is single-pass type I membrane protein. As receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. The GPI-anchored ephrin-A EFNA2, EFNA3, and EFNA5 are able to activate EPHA8 through phosphorylation. During development of the nervous system plays also a role in axon guidance. Downstream effectors of the EPHA8 signaling pathway include FYN which promotes cell adhesion upon activation by EPHA8 and the MAP kinases in the stimulation of neurite outgrowth.

Function: Receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. The GPI-anchored ephrin-A EFNA2, EFNA3, and EFNA5 are able to activate EPHA8 through phosphorylation. With EFNA5 may regulate integrin-mediated cell adhesion and migration on fibronectin substrate but also neurite outgrowth. During development of the nervous system plays also a role in axon guidance. Downstream effectors of the EPHA8 signaling pathway include FYN which promotes cell adhesion upon activation by EPHA8 and the MAP kinases in the stimulation of neurite outgrowth (By similarity).

Product Categories/Family for EPHA8 active protein

Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 55770892
• NCBI GeneID: 2046
• NCBI Accession #: NP_001006944
• NCBI GenBank Nucleotide #: NM_001006943.2
• UniProt Accession #: P29322
• Molecular Weight: 78.4 kDa
• NCBI Official Full Name: ephrin type-A receptor 8 isoform 2
• NCBI Official Synonym Full Names: EPH receptor A8
• NCBI Official Symbol: EPHA8
• NCBI Official Synonym Symbols: EEK; EK3; HEK3
• NCBI Protein Information: ephrin type-A receptor 8
• UniProt Protein Name: Ephrin type-A receptor 8
• Protein Family: Ephrin type-A receptor
• UniProt Gene Name: EPHA8
• UniProt Synonym Gene Names: EEK; HEK3; KIAA1459; EK3; hEK3
• UniProt Entry Name: EPHA8_HUMAN

NCBI Description

This gene encodes a member of the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. The protein encoded by this gene functions as a receptor for ephrin A2, A3 and A5 and plays a role in short-range contact-mediated axonal guidance during development of the mammalian nervous system. [provided by RefSeq, Jul 2008]