Ephrin-A1 (Efna1) Active Protein | Efna1 active protein

Recombinant Mouse Ephrin-A1 (Efna1), Partial

Cat. Num. AAA7115174

• Gene Names: Efna1; B61; Efl1; Epl1; Eplg1; Lerk1; AI325262
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Ephrin-A1 (Efna1); Recombinant Mouse Ephrin-A1 (Efna1); Partial; EPH-related receptor tyrosine kinase ligand 1; Immediate early response protein B61; Epgl1; Epl1; Lerk1; Efna1 active protein

• Host: Mammalian Cell
• Specificity: Expressed in myogenic progenitor cells.
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 mum Filtered 1xPBS, pH 7.4
• Sequence Positions: 19-182aa; Partial
• Sequence: DRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYEDDSVADAAMERYTLYMVEHQEYVACQPQSKDQVRWNCNRPSAKHGPEKLSEKFQRFTPFILGKEFKEGHSYYYISKPIYHQESQCLKLKVTVNGKITHNPQAHVNPQEKRLQADDPEVQVLHSIGYS
• Sequence Length: 205

• Species: Mouse
• Tag: C-terminal 6xHis-FC-tagged
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Biological Activity: The ED50 as determined by its ability to bind Human EphA2 in functional ELISA is less than 20 ug/ml.
• Subcellular Location: Cell Membrane, Lipid-Anchor, GPI-Anchor, SUBCELLULAR LOCATION: Ephrin-A1, Secreted form: Secreted
• Protein Families: Ephrin Family
• Classification: Other Recombinant Protein
• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for Efna1 active protein

Relevance: Ephrin-A1 is a cell membrane protein and contains 1 ephrin RBD (ephrin receptor-binding) domain. EFNA1 belongs to the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin which binds to the EPHA2, EPHA4, EPHA5, EPHA6, and EPHA7 receptors. Two transcript variants that encode different isoforms were identified through sequence analysis. It belongs to the ephrin family and contains 1 ephrin RBD (ephrin receptor-binding) domain.

Function: Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. Plays an important role in angiogenesis and tumor neovascularization. The recruitment of VAV2, VAV3 and PI3-kinase p85 subunit by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly. Exerts anti-oncogenic effects in tumor cells through activation and down-regulation of EPHA2. Activates EPHA2 by inducing tyrosine phosphorylation which leads to its internalization and degradation. Acts as a negative regulator in the tumorigenesis of gliomas by down-regulating EPHA2 and FAK. Can evoke collapse of embryonic neuronal growth cone and regulates dendritic spine morphogenesis.

Product Categories/Family for Efna1 active protein

Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 247269690
• NCBI GeneID: 13636
• NCBI Accession #: NP_034237.3
• NCBI GenBank Nucleotide #: NM_010107.4
• UniProt Accession #: P52793
• Molecular Weight: 47.3 kDa
• NCBI Official Full Name: ephrin-A1 isoform 1
• NCBI Official Synonym Full Names: ephrin A1
• NCBI Official Symbol: Efna1
• NCBI Official Synonym Symbols: B61; Efl1; Epl1; Eplg1; Lerk1; AI325262
• NCBI Protein Information: ephrin-A1
• UniProt Protein Name: Ephrin-A1
• Protein Family: Ephrin
• UniProt Gene Name: Efna1
• UniProt Synonym Gene Names: Epgl1; Epl1; Lerk1; LERK-1

Uniprot Description

EFNA1: Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. Plays an important role in angiogenesis and tumor neovascularization. The recruitment of VAV2, VAV3 and PI3-kinase p85 subunit by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly. Exerts anti-oncogenic effects in tumor cells through activation and down-regulation of EPHA2. Activates EPHA2 by inducing tyrosine phosphorylation which leads to its internalization and degradation. Acts as a negative regulator in the tumorigenesis of gliomas by down-regulating EPHA2 and FAK. Can evoke collapse of embryonic neuronal growth cone and regulates dendritic spine morphogenesis. Belongs to the ephrin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation; Ligand, receptor tyrosine kinase; Membrane protein, GPI anchor; Tumor suppressor

Chromosomal Location of Human Ortholog: 3 F1|3 39.04 cM

Cellular Component: anchored to plasma membrane

Molecular Function: ephrin receptor binding; protein binding

Biological Process: activation of MAPK activity; axon guidance; cell migration; ephrin receptor signaling pathway; MAPKKK cascade; negative regulation of transcription from RNA polymerase II promoter; neuron differentiation; notochord formation; positive regulation of peptidyl-tyrosine phosphorylation; regulation of angiogenesis; regulation of axonogenesis; regulation of blood vessel endothelial cell migration; regulation of cell adhesion mediated by integrin; regulation of peptidyl-tyrosine phosphorylation