Carbonic Anhydrase 14 (Ca14) Active Protein | Ca14 active protein
Recombinant Mouse Carbonic Anhydrase 14 (Ca14), Partial
Gene Names
Car14; Ca14; CA-XIV; AW536446
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Carbonic Anhydrase 14 (Ca14); Recombinant Mouse Carbonic Anhydrase 14 (Ca14); Partial; Carbonic Anhydrase 14; Carbonate Dehydratase XIV; Carbonic Anhydrase XIV; CA-XIV; CA14; Ca14 active protein
Host
Mammalian Cell
Specificity
Most abundant in the kidney and heart, followed by the skeletal muscle, brain, lung and liver.
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
0.2 mum Filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
Sequence Positions
16-290aa; Partial
Sequence
ADGGHHWTYEGPHGQDHWPTSYPECGGDAQSPINIQTDSVIFDPDLPAVQPHGYDQLGTEPLDLHNNGHTVQLSLPPTLHLGGLPRKYTAAQLHLHWGQRGSLEGSEHQINSEATAAELHVVHYDSQSYSSLSEAAQKPQGLAVLGILIEVGETENPAYDHILSRLHEIRYKDQKTSVPPFSVRELFPQQLEQFFRYNGSLTTPPCYQSVLWTVFNRRAQISMGQLEKLQETLSSTEEDPSEPLVQNYRVPQPLNQRTIFASFIQAGPLYTTGEM
Sequence Length
337
Species
Mouse
Tag
C-terminal 6xHis-tagged
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The esterase activity is determined to be greater than 400 pmol/min/ug.
Subcellular Location
Membrane, Single-Pass Type I Membrane Protein
Protein Families
Alpha-Carbonic Anhydrase Family
Classification
Other Recombinant Protein
Preparation and Storage
Store at -20 degree C. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for Ca14 active protein
Relevance: Mouse Ca14, also known as Carbonic anhydrase 14, is a member of large family of zinc metalloenzymes. It could catalyze reversible hydration of carbon dioxide. The reaction is fundamental to many processes such as respiration, renal tubular acidification and bone resorption. Fifteen CA isoforms have been reported so far. They have different patterns of tissue-specific expression and physiologic roles. Some CAs may serve as markers for tumors and hypoxia. CA XIV is a polypeptide consisting of an extracellular N-terminal catalytic domain, a membrane-spanning segment and a short intracellular C- terminal segment with several potential phosphorylation sites. A subset of CAs lack CA activity due to point mutations but retain esterase function. CA14 is widely expressed in the central nervous system.
Function: Reversible hydration of carbon dioxide.
Function: Reversible hydration of carbon dioxide.
Product Categories/Family for Ca14 active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31.8 kDa
NCBI Official Full Name
carbonic anhydrase 14 isoform 1
NCBI Official Synonym Full Names
carbonic anhydrase 14
NCBI Official Symbol
Car14
NCBI Official Synonym Symbols
Ca14; CA-XIV; AW536446
NCBI Protein Information
carbonic anhydrase 14
UniProt Protein Name
Carbonic anhydrase 14
Protein Family
UniProt Gene Name
Ca14
UniProt Synonym Gene Names
Car14; Catm; CA-XIV
Uniprot Description
CA14: Reversible hydration of carbon dioxide. Belongs to the alpha-carbonic anhydrase family.
Protein type: EC 4.2.1.1; Energy Metabolism - nitrogen; Lyase; Membrane protein, integral
Chromosomal Location of Human Ortholog: 3|3 F2.1
Cellular Component: integral component of membrane; membrane
Molecular Function: carbonate dehydratase activity; lyase activity; metal ion binding
Biological Process: carbon dioxide transport; regulation of pH
Research Articles on Ca14
Similar Products
Product Notes
The Ca14 ca14 (Catalog #AAA7115175) is an Active Protein produced from Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 16-290aa; Partial. The amino acid sequence is listed below: ADGGHHWTYE GPHGQDHWPT SYPECGGDAQ SPINIQTDSV IFDPDLPAVQ PHGYDQLGTE PLDLHNNGHT VQLSLPPTLH LGGLPRKYTA AQLHLHWGQR GSLEGSEHQI NSEATAAELH VVHYDSQSYS SLSEAAQKPQ GLAVLGILIE VGETENPAYD HILSRLHEIR YKDQKTSVPP FSVRELFPQQ LEQFFRYNGS LTTPPCYQSV LWTVFNRRAQ ISMGQLEKLQ ETLSSTEEDP SEPLVQNYRV PQPLNQRTIF ASFIQAGPLY TTGEM. It is sometimes possible for the material contained within the vial of "Carbonic Anhydrase 14 (Ca14), Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
