Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

M1-1 protoxin Recombinant Protein | SckvM1gp1 recombinant protein

Recombinant Saccharomyces cerevisiae killer virus M1 M1-1 protoxin

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
M1-1 protoxin; Recombinant Saccharomyces cerevisiae killer virus M1 M1-1 protoxin; Recombinant M1-1 protoxin; Killer toxin K1 Cleaved into the following 4 chains: 1. M1-1 delta chain 2. M1-1 alpha chain 3. M1-1 gamma immunity chain 4. M1-1 beta chain; SckvM1gp1 recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
234-316
Sequence
YVYPMCEHGIKASYCMALNDAMVSANGNLYGLAEKLFSEDEGQWETNYYKLYWSTGQWIMSMKFIEESIDNANNDFEGCDTGH
Sequence Length
316
Species
Saccharomyces cerevisiae killer virus M1 (ScV-M1) (Saccharomyces cerevisiae virus M1)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34,826 Da
NCBI Official Full Name
preprotoxin
NCBI Official Symbol
SckvM1gp1
NCBI Protein Information
preprotoxin
UniProt Protein Name
M1-1 protoxin
Protein Family
UniProt Entry Name
M11P_SCVM1

Uniprot Description

Function: Ionophoric toxin secreted by an infected host and lethal to non-infected sensitive strains. Cell killing is achieved in a receptor-mediated process, requiring initial toxin binding to a cell wall (1->6)-beta-D-glucan and, probably, subsequent transfer to a plasma membrane receptor. K1 toxin disrupts the cell by creating a pore across the target cell membrane. Ref.4

Subunit structure: The secreted toxin contains alpha and beta chains that are linked by three disulfide bonds.

Subcellular location: Secreted. Host membrane; Multi-pass membrane protein

Potential. Note: Pore-forming in target cell

Probable.

Miscellaneous: The killer phenotype requires the presence of two different dsRNA viruses: an L-A helper virus and the toxin-coding (M) killer virus. Killer strains of S.cerevisiae producing the toxin K1 kill sensitive cells but are resistant to their own toxin. The gamma and delta chains may play a role, on there own or as part of the protoxin, in the self-protection of the virus-infected killer yeast (toxin immunity).

Similar Products

Product Notes

The SckvM1gp1 (Catalog #AAA1019673) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 234-316. The amino acid sequence is listed below: YVYPMCEHGI KASYCMALND AMVSANGNLY GLAEKLFSED EGQWETNYYK LYWSTGQWIM SMKFIEESID NANNDFEGCD TGH. It is sometimes possible for the material contained within the vial of "M1-1 protoxin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.