Western Blot (WB)
(Western Blot analysis of SYNJ2 expression in transfected 293T cell line by SYNJ2 monoclonal antibody Lane 1: SYNJ2 transfected lysate (92.2kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human SYNJ2 Monoclonal Antibody | anti-SYNJ2 antibody
SYNJ2 (Synaptojanin-2, Synaptic Inositol 1,4,5-trisphosphate 5-phosphatase 2, INPP5H, KIAA0348) (AP)
Gene Names
SYNJ2; INPP5H
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SYNJ2; Monoclonal Antibody; SYNJ2 (Synaptojanin-2; Synaptic Inositol 1; 4; 5-trisphosphate 5-phosphatase 2; INPP5H; KIAA0348) (AP); EC=3.1.3.36; anti-SYNJ2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2H8
Specificity
Recognizes human SYNJ2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SYNJ2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1396-1496 from SYNJ2 (NP_003889) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GTKAMKPEAAPLLGDYQDPFWNLLHHPKLLNNTWLSKSSDPLDSGTRSPKRDPIDPVSAGASAAKAELPPDHEHKTLGHWVTISDQEKRTALQVFDPLAK
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of SYNJ2 expression in transfected 293T cell line by SYNJ2 monoclonal antibody Lane 1: SYNJ2 transfected lysate (92.2kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of SYNJ2 expression in transfected 293T cell line by SYNJ2 monoclonal antibody Lane 1: SYNJ2 transfected lysate (92.2kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot detection against Immunogen (37.11kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (37.11kD).)
Western Blot (WB)
(Western blot analysis of SYNJ2 over-expressed 293 cell line, cotransfected with SYNJ2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with SYNJ2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)
Western Blot (WB)
(Western blot analysis of SYNJ2 over-expressed 293 cell line, cotransfected with SYNJ2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with SYNJ2 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-SYNJ2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
165kDa
NCBI Official Full Name
synaptojanin-2 isoform 1
NCBI Official Synonym Full Names
synaptojanin 2
NCBI Official Symbol
SYNJ2
NCBI Official Synonym Symbols
INPP5H
NCBI Protein Information
synaptojanin-2
UniProt Protein Name
Synaptojanin-2
Protein Family
UniProt Gene Name
SYNJ2
UniProt Synonym Gene Names
KIAA0348
UniProt Entry Name
SYNJ2_HUMAN
NCBI Description
The gene is a member of the inositol-polyphosphate 5-phosphatase family. The encoded protein interacts with the ras-related C3 botulinum toxin substrate 1, which causes translocation of the encoded protein to the plasma membrane where it inhibits clathrin-mediated endocytosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2010]
Research Articles on SYNJ2
Similar Products
Product Notes
The SYNJ2 synj2 (Catalog #AAA6134089) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SYNJ2 (Synaptojanin-2, Synaptic Inositol 1,4,5-trisphosphate 5-phosphatase 2, INPP5H, KIAA0348) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SYNJ2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SYNJ2 synj2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SYNJ2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
