General odorant-binding protein lush (lush) Recombinant Protein | lush recombinant protein

Recombinant Drosophila melanogaster General odorant-binding protein lush (lush)

Cat. Num. AAA1016639

• Gene Names: lush; 76a; 76c; 76c(LUSH); CG8807; DmelObp76a; DmelCG8807; Lush; LUSH; obp76a; Obp76a
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: General odorant-binding protein lush (lush); Recombinant Drosophila melanogaster General odorant-binding protein lush (lush); General odorant-binding protein lush; lush recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 30-153aa; Full Length of Mature Protein
• Sequence: MTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTKCVSLMAGTVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENADGQFMWP
• Sequence Length: 153

• Species: Drosophila melanogaster (Fruit fly)
• Production Note: Special Offer: The E. coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E. coli host-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E. coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E. coli host-expressed protein for the fastest delivery among all hosts. Please contact us or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

Related Product Information for lush recombinant protein

Odorant-binding protein required for olfactory behavior and for activity of pheromone-sensitive neurons. Binds to alcohols and mediates avoidance behavior to high concentrations of alcohols, the alcohol-binding possibly resulting in activation of receptors on T2B neurons, the activation of these receptors inhibiting these neurons. Acts in concert with Snmp and lush to capture cVA molecules on the surface of Or67d expressing olfactory dendrites and facilitate their transfer to the odorant-receptor Orco complex. Required for cVA response, probably by binding to VA. May act by serving as an adapter that bridges the presence of gaseous pheromone molecules, cVA, to activation of specific neuronal receptors expressed on T1 olfactory neurons, possibly via a specific conformational change induced by cVA that in turn activates T1 receptors. T1 neurons are excited by the pheromone VA, while T2 neurons are inhibited by alcohols. Also binds to phthalates.

NCBI and Uniprot Product Information

• NCBI GI #: 281366436
• NCBI GeneID: 40136
• NCBI Accession #: NP_001163468.1
• NCBI GenBank Nucleotide #: NM_001169997.1
• UniProt Accession #: O02372; Q29QG4; E1JI39
• Molecular Weight: 19.2 kDa
• NCBI Official Full Name: lush, isoform B
• NCBI Official Symbol: lush
• NCBI Official Synonym Symbols: 76a; 76c; 76c(LUSH); CG8807; DmelObp76a; DmelCG8807; Lush; LUSH; obp76a; Obp76a
• NCBI Protein Information: CG8807 gene product from transcript CG8807-RA; CG8807-PA; CG8807-PB; lush; lush-PA; lush-PB
• UniProt Protein Name: General odorant-binding protein lush
• Protein Family: General odorant-binding protein
• UniProt Gene Name: lush
• UniProt Synonym Gene Names: Obp76a; Obp76c
• UniProt Entry Name: OB76A_DROME

Uniprot Description

Odorant-binding protein required for olfactory behavior and for activity of pheromone-sensitive neurons. Binds to alcohols and mediates avoidance behavior to high concentrations of alcohols, the alcohol-binding possibly resulting in activation of receptors on T2B neurons, the activation of these receptors inhibiting these neurons. Acts in concert with Snmp and lush to capture cVA molecules on the surface of Or67d expressing olfactory dendrites and facilitate their transfer to the odorant-receptor Orco complex. Required for cVA response, probably by binding to VA. May act by serving as an adapter that bridges the presence of gaseous pheromone molecules, cVA, to activation of specific neuronal receptors expressed on T1 olfactory neurons, possibly via a specific conformational change induced by cVA that in turn activates T1 receptors. T1 neurons are excited by the pheromone VA, while T2 neurons are inhibited by alcohols. Also binds to phthalates.