Lymphotoxin-beta (Ltb) Recombinant Protein | Ltb recombinant protein
Recombinant Mouse Lymphotoxin-beta (Ltb), partial
Gene Names
Ltb; p33; Tnfc; LTbeta; Tnfsf3; Tnlg1c; AI662801
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lymphotoxin-beta (Ltb); Recombinant Mouse Lymphotoxin-beta (Ltb); partial; Ltb recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
49-306aa, Extracellular domain
Sequence
QDQGRRVEKIIGSGAQAQKRLDDSKPSCILPSPSSLSETPDPRLHPQRSNASRNLASTSQGPVAQSSREASAWMTILSPAADSTPDPGVQQLPKGEPETDLNPELPAAHLIGAWMSGQGLSWEASQEEAFLRSGAQFSPTHGLALPQDGVYYLYCHVGYRGRTPPAGRSRARSLTLRSALYRAGGAYGRGSPELLLEGAETVTPVVDPIGYGSLWYTSVGFGGLAQLRSGERVYVNISHPDMVDYRRGKTFFGAVMVG
Sequence Length
306
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Ltb recombinant protein
Lymphotoxin beta is a type II membrane protein of the TNF family. It anchors lymphotoxin-alpha to the cell surface through heterotrimer formation. The predominant form on the lymphocyte surface is the lymphotoxin-alpha 1
beta 2 complex (e.g. 1 molecule alpha
2 molecules beta) and this complex is the primary ligand for the lymphotoxin-beta receptor. The minor complex is lymphotoxin-alpha 2
beta 1. LTB is an inducer of the inflammatory response system and involved in normal development of lymphoid tissue. Lymphotoxin-beta isoform b is unable to complex with lymphotoxin-alpha suggesting a function for lymphotoxin-beta which is independent of lympyhotoxin-alpha. Alternative splicing results in multiple transcript variants encoding different isoforms.
beta 2 complex (e.g. 1 molecule alpha
2 molecules beta) and this complex is the primary ligand for the lymphotoxin-beta receptor. The minor complex is lymphotoxin-alpha 2
beta 1. LTB is an inducer of the inflammatory response system and involved in normal development of lymphoid tissue. Lymphotoxin-beta isoform b is unable to complex with lymphotoxin-alpha suggesting a function for lymphotoxin-beta which is independent of lympyhotoxin-alpha. Alternative splicing results in multiple transcript variants encoding different isoforms.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,329 Da
NCBI Official Full Name
lymphotoxin-beta
NCBI Official Synonym Full Names
lymphotoxin B
NCBI Official Symbol
Ltb
NCBI Official Synonym Symbols
p33; Tnfc; LTbeta; Tnfsf3; Tnlg1c; AI662801
NCBI Protein Information
lymphotoxin-beta
UniProt Protein Name
Lymphotoxin-beta
Protein Family
UniProt Gene Name
Ltb
UniProt Synonym Gene Names
Tnfc; Tnfsf3; LT-beta; TNF-C
Uniprot Description
Cytokine that binds to LTBR/TNFRSF3. May play a specific role in immune response regulation. Provides the membrane anchor for the attachment of the heterotrimeric complex to the cell surface.
Research Articles on Ltb
Similar Products
Product Notes
The Ltb ltb (Catalog #AAA951659) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 49-306aa, Extracellular domain. The amino acid sequence is listed below: QDQGRRVEKI IGSGAQAQKR LDDSKPSCIL PSPSSLSETP DPRLHPQRSN ASRNLASTSQ GPVAQSSREA SAWMTILSPA ADSTPDPGVQ QLPKGEPETD LNPELPAAHL IGAWMSGQGL SWEASQEEAF LRSGAQFSPT HGLALPQDGV YYLYCHVGYR GRTPPAGRSR ARSLTLRSAL YRAGGAYGRG SPELLLEGAE TVTPVVDPIG YGSLWYTSVG FGGLAQLRSG ERVYVNISHP DMVDYRRGKT FFGAVMVG. It is sometimes possible for the material contained within the vial of "Lymphotoxin-beta (Ltb), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
