Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Limbic system-associated membrane protein (Lsamp) Recombinant Protein | Lsamp recombinant protein

Recombinant Rat Limbic system-associated membrane protein (Lsamp)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Limbic system-associated membrane protein (Lsamp); Recombinant Rat Limbic system-associated membrane protein (Lsamp); Lsamp recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
29-315, full length protein
Sequence
VRSVDFNRGTDNITVRQGDTAILRCVVEDKNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHALEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRPEPVITWRHLTPLGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFRPGSVRGIN
Sequence Length
287
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Lsamp recombinant protein
This protein is a neuronal surface glycoprotein found in cortical and subcortical regions of the limbic system. During development of the limbic system, this encoded protein is found on the surface of axonal membranes and growth cones, where it acts as a selective homophilic adhesion molecule, and guides the development of specific patterns of neuronal connections.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,861 Da
NCBI Official Full Name
limbic system-associated membrane protein
NCBI Official Synonym Full Names
limbic system-associated membrane protein
NCBI Official Symbol
Lsamp
NCBI Protein Information
limbic system-associated membrane protein
UniProt Protein Name
Limbic system-associated membrane protein
UniProt Gene Name
Lsamp
UniProt Synonym Gene Names
Lamp; LSAMP

NCBI Description

immunoglobulin (Ig) superfamily member; may act as a recognition molecule for the formation of neuronal connections [RGD, Feb 2006]

Uniprot Description

Mediates selective neuronal growth and axon targeting. Contributes to the guidance of developing axons and remodeling of mature circuits in the limbic system. Essential for normal growth of the hyppocampal mossy fiber projection.

Research Articles on Lsamp

Similar Products

Product Notes

The Lsamp lsamp (Catalog #AAA1469089) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 29-315, full length protein. The amino acid sequence is listed below: VRSVDFNRGT DNITVRQGDT AILRCVVEDK NSKVAWLNRS GIIFAGHDKW SLDPRVELEK RHALEYSLRI QKVDVYDEGS YTCSVQTQHE PKTSQVYLIV QVPPKISNIS SDVTVNEGSN VTLVCMANGR PEPVITWRHL TPLGREFEGE EEYLEILGIT REQSGKYECK AANEVSSADV KQVKVTVNYP PTITESKSNE ATTGRQASLK CEASAVPAPD FEWYRDDTRI NSANGLEIKS TEGQSSLTVT NVTEEHYGNY TCVAANKLGV TNASLVLFRP GSVRGIN. It is sometimes possible for the material contained within the vial of "Limbic system-associated membrane protein (Lsamp), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.