Lipoprotein-releasing system transmembrane protein LolC (lolC) Recombinant Protein | lolC recombinant protein
Recombinant Escherichia coli Lipoprotein-releasing system transmembrane protein LolC (lolC)
Gene Names
lolC; ECK1102; JW5161; ycfU
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lipoprotein-releasing system transmembrane protein LolC (lolC); Recombinant Escherichia coli Lipoprotein-releasing system transmembrane protein LolC (lolC); Recombinant Lipoprotein-releasing system transmembrane protein LolC (lolC); Lipoprotein-releasing system transmembrane protein LolC; lolC recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-399
Sequence
MYQPVALFIGLRYMRGRAADRFGRFVSWLSTIGITLGVMALVTVLSVMNGFERELQNNILGLMPQAILSSEHGSLNPQQLPETAVKLDGVNRVAPITTGDVVLQSARSVAVGVMLGIDPAQKDPLTPYLVNVKQTDLEPGKYNVILGEQLASQLGVNRGDQIRVMVPSASQFTPMGRIPSQRLFNVIGTFAANSEVDGYEMLVNIEDASRLMRYPAGNITGWRLWLDEPLKVDSLSQQKLPEGSKWQDWRDRKGELFQAVRMEKNMMGLLLSLIVAVAAFNIITSLGLMVMEKQGEVAILQTQGLTPRQIMMVFMVQGASAGIIGAILGAALGALLASQLNNLMPIIGVLLDGAALPVAIEPLQVIVIALVAMAIALLSTLYPSWRAAATQPAEALRYE
Sequence Length
399
Species
Escherichia coli (strain K12)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
43,264 Da
NCBI Official Full Name
lipoprotein-releasing system transmembrane protein
NCBI Official Symbol
lolC
NCBI Official Synonym Symbols
ECK1102; JW5161; ycfU
NCBI Protein Information
lipoprotein-releasing system transmembrane protein
UniProt Protein Name
Lipoprotein-releasing system transmembrane protein LolC
Protein Family
UniProt Gene Name
lolC
UniProt Synonym Gene Names
ycfU
UniProt Entry Name
LOLC_ECOLI
NCBI Description
LolC is a membrane component of the LolCDE lipoprotein export ABC transporter. [More information is available at EcoCyc: G6573].
Uniprot Description
Function: Part of an ATP-dependent transport system LolCDE responsible for the release of lipoproteins targeted to the outer membrane from the inner membrane. Such a release is dependent of the sorting-signal (absence of an Asp at position 2 of the mature lipoprotein) and of LolA.
Subcellular location: Cell inner membrane; Multi-pass membrane protein.
Sequence similarities: Belongs to the ABC-4 integral membrane protein family. LolC/E subfamily.
Research Articles on lolC
Similar Products
Product Notes
The lolC lolc (Catalog #AAA1137178) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-399. The amino acid sequence is listed below: MYQPVALFIG LRYMRGRAAD RFGRFVSWLS TIGITLGVMA LVTVLSVMNG FERELQNNIL GLMPQAILSS EHGSLNPQQL PETAVKLDGV NRVAPITTGD VVLQSARSVA VGVMLGIDPA QKDPLTPYLV NVKQTDLEPG KYNVILGEQL ASQLGVNRGD QIRVMVPSAS QFTPMGRIPS QRLFNVIGTF AANSEVDGYE MLVNIEDASR LMRYPAGNIT GWRLWLDEPL KVDSLSQQKL PEGSKWQDWR DRKGELFQAV RMEKNMMGLL LSLIVAVAAF NIITSLGLMV MEKQGEVAIL QTQGLTPRQI MMVFMVQGAS AGIIGAILGA ALGALLASQL NNLMPIIGVL LDGAALPVAI EPLQVIVIAL VAMAIALLST LYPSWRAAAT QPAEALRYE. It is sometimes possible for the material contained within the vial of "Lipoprotein-releasing system transmembrane protein LolC (lolC), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
