Hormone-sensitive lipase (LIPE) Recombinant Protein | LIPE recombinant protein
Recombinant Bovine Hormone-sensitive lipase (LIPE) , partial
Gene Names
LIPE; hsl
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Hormone-sensitive lipase (LIPE); Recombinant Bovine Hormone-sensitive lipase (LIPE); partial; LIPE recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
535-680; Partial.
Sequence
GQKSHLKSVSKTEPMRRSVSEAALTQPEGSLGTDSLKSLKLHDLGLRNSSDTTDTPELSLSAETLGPSAPSTINFLLGSEDGSEMSKAPEELNNKDRVRGVGAAFPEGFHPRRCSQGAMWMPLYSAPIVKNPSMSPLLAPDSMLQT
Sequence Length
680
Species
Bovine
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for LIPE recombinant protein
This protein has a long and a short form, generated by use of alternative translational start codons. The long form is expressed in steroidogenic tissues such as testis, where it converts cholesteryl esters to free cholesterol for steroid hormone production. The short form is expressed in adipose tissue, among others, where it hydrolyzes stored triglycerides to free fatty acids.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
82,641 Da
NCBI Official Full Name
hormone-sensitive lipase
NCBI Official Symbol
LIPE
NCBI Official Synonym Symbols
hsl
NCBI Protein Information
hormone-sensitive lipase
UniProt Protein Name
Hormone-sensitive lipase
Protein Family
UniProt Gene Name
LIPE
UniProt Synonym Gene Names
HSL
Uniprot Description
In adipose tissue and heart, it primarily hydrolyzes stored triglycerides to free fatty acids, while in steroidogenic tissues, it principally converts cholesteryl esters to free cholesterol for steroid hormone production.
Research Articles on LIPE
Similar Products
Product Notes
The LIPE lipe (Catalog #AAA949241) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 535-680; Partial. The amino acid sequence is listed below: GQKSHLKSVS KTEPMRRSVS EAALTQPEGS LGTDSLKSLK LHDLGLRNSS DTTDTPELSL SAETLGPSAP STINFLLGSE DGSEMSKAPE ELNNKDRVRG VGAAFPEGFH PRRCSQGAMW MPLYSAPIVK NPSMSPLLAP DSMLQT . It is sometimes possible for the material contained within the vial of "Hormone-sensitive lipase (LIPE), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
