Leukocyte immunoglobulin-like receptor subfamily A member 5 Recombinant Protein | LILRA5 recombinant protein

Recombinant Human Leukocyte immunoglobulin-like receptor subfamily A member 5

Cat. Num. AAA1070754

• Gene Names: LILRA5; CD85; LIR9; CD85F; ILT11; LIR-9; ILT-11; LILRB7
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Leukocyte immunoglobulin-like receptor subfamily A member 5; Recombinant Human Leukocyte immunoglobulin-like receptor subfamily A member 5; CD85 antigen-like family member F; Immunoglobulin-like transcript 11; ILT-11; Leukocyte immunoglobulin-like receptor 9; LIR-9; CD85f; LILRA5 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 42-268aa; Extracellular Domain
• Sequence: GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR
• Sequence Length: 299

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for LILRA5 recombinant protein

May play a role in triggering innate immune responses. Does not se to play a role for any class I MHC antigen recognition.

Product Categories/Family for LILRA5 recombinant protein

Immunology

References

Extensive gene duplications and a large inversion characterize the human leukocyte receptor cluster.Wende H., Volz A., Ziegler A.Immunogenetics 51:703-713(2000) LIR9, an immunoglobulin-superfamily-activating receptor, is expressed as a transmembrane and as a secreted molecule.Borges L., Kubin M., Kuhlman T.Blood 101:1484-1486(2003) The DNA sequence and biology of human chromosome 19.Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V., Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.Nature 428:529-535(2004)

NCBI and Uniprot Product Information

• NCBI GI #: 32490553
• NCBI GeneID: 353514
• NCBI Accession #: NP_067073.1
• NCBI GenBank Nucleotide #: NM_021250.3
• UniProt Accession #: A6NI73; A6NHI3
• Molecular Weight: 27.2 kDa
• NCBI Official Full Name: leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1
• NCBI Official Synonym Full Names: leukocyte immunoglobulin like receptor A5
• NCBI Official Symbol: LILRA5
• NCBI Official Synonym Symbols: CD85; LIR9; CD85F; ILT11; LIR-9; ILT-11; LILRB7
• NCBI Protein Information: leukocyte immunoglobulin-like receptor subfamily A member 5
• UniProt Protein Name: Leukocyte immunoglobulin-like receptor subfamily A member 5
• Protein Family: Leukocyte immunoglobulin-like receptor subfamily
• UniProt Gene Name: LILRA5
• UniProt Synonym Gene Names: ILT11; LILRB7; LIR9; ILT-11; LIR-9
• UniProt Entry Name: LIRA5_HUMAN

NCBI Description

The protein encoded by this gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family. LIR family members are known to have activating and inibitory functions in leukocytes. Crosslink of this receptor protein on the surface of monocytes has been shown to induce calcium flux and secretion of several proinflammatory cytokines, which suggests the roles of this protein in triggering innate immune responses. This gene is one of the leukocyte receptor genes that form a gene cluster on the chromosomal region 19q13.4. Four alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

LILRA5: May play a role in triggering innate immune responses. Does not seem to play a role for any class I MHC antigen recognition. 4 isoforms of the human protein are produced by alternative splicing

Chromosomal Location of Human Ortholog: 19q13.4