Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Galectin-9 (Lgals9) Recombinant Protein | Lgals9 recombinant protein

Recombinant Mouse Galectin-9 (Lgals9)

Gene Names
Lgals9; gal-9; Lgals5; LGALS35; AA407335; AI194909; AI265545; galectin-9
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Galectin-9 (Lgals9); Recombinant Mouse Galectin-9 (Lgals9); Lgals9 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-353, Full length protein
Sequence
MALFSAQSPYINPIIPFTGPIQGGLQEGLQVTLQGTTKSFAQRFVVNFQNSFNGNDIAFHFNPRFEEGGYVVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLVQRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKLSFITFQNSAAPVQHVFSTLQFSQPVQFPRTPKGRKQKTQNFRPAHQAPMAQTTIHMVHSTPGQMFSTPGIPPVVYPTPAYTIPFYTPIPNGLYPSKSIMISGNVLPDATRFHINLRCGGDIAFHLNPRFNENAVVRNTQINNSWGQEERSLLGRMPFSRGQSFSVWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQLTHVQT
Sequence Length
353
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Lgals9 recombinant protein
The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. This protein is an S-type lectin. It is overexpressed in Hodgkin s disease tissue and might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and
or its associated immunodeficiency. Multiple alternatively spliced transcript variants have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,164 Da
NCBI Official Full Name
galectin-9 isoform 2
NCBI Official Synonym Full Names
lectin, galactose binding, soluble 9
NCBI Official Symbol
Lgals9
NCBI Official Synonym Symbols
gal-9; Lgals5; LGALS35; AA407335; AI194909; AI265545; galectin-9
NCBI Protein Information
galectin-9
UniProt Protein Name
Galectin-9
Protein Family
UniProt Gene Name
Lgals9
UniProt Synonym Gene Names
Gal-9

Uniprot Description

Binds galactosides (). Has high affinity for the Forssman pentasaccharide (). Ligand for HAVCR2/TIM3 (). Binding to HAVCR2 induces T-helper type 1 lymphocyte (Th1) death (). Also stimulates bactericidal activity in infected macrophages by causing macrophage activation and IL1B secretion which restricts intracellular bacterial growth (PubMed:20937702). Ligand for P4HB; the interaction retains P4HB at the cell surface of Th2 T-helper cells, increasing disulfide reductase activity at the plasma membrane, altering the plasma membrane redox state and enhancing cell migration (PubMed:21670307). Ligand for CD44; the interaction enhances binding of SMAD3 to the FOXP3 promoter, leading to up-regulation of FOXP3 expression and increased induced regulatory T (iTreg) cell stability and suppressive function (PubMed:25065622). Promotes ability of mesenchymal stromal cells to suppress T-cell proliferation (). Expands regulatory T-cells and induces cytotoxic T-cell apoptosis following virus infection (). Activates ERK1/2 phosphorylation inducing cytokine (IL-6, IL-8, IL-12) and chemokine (CCL2) production in mast and dendritic cells (). Inhibits degranulation and induces apoptosis of mast cells (). Induces maturation and migration of dendritic cells (). Inhibits natural killer (NK) cell function (PubMed:23408620). Can transform NK cell phenotype from peripheral to decidual during pregnancy (). Astrocyte derived galectin-9 enhances microglial TNF production (PubMed:25158758). May play a role in thymocyte-epithelial interactions relevant to the biology of the thymus. May provide the molecular basis for urate flux across cell membranes, allowing urate that is formed during purine metabolism to efflux from cells and serving as an electrogenic transporter that plays an important role in renal and gastrointestinal urate excretion (). Highly selective to the anion urate ().

Research Articles on Lgals9

Similar Products

Product Notes

The Lgals9 lgals9 (Catalog #AAA1009364) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-353, Full length protein. The amino acid sequence is listed below: MALFSAQSPY INPIIPFTGP IQGGLQEGLQ VTLQGTTKSF AQRFVVNFQN SFNGNDIAFH FNPRFEEGGY VVCNTKQNGQ WGPEERKMQM PFQKGMPFEL CFLVQRSEFK VMVNKKFFVQ YQHRVPYHLV DTIAVSGCLK LSFITFQNSA APVQHVFSTL QFSQPVQFPR TPKGRKQKTQ NFRPAHQAPM AQTTIHMVHS TPGQMFSTPG IPPVVYPTPA YTIPFYTPIP NGLYPSKSIM ISGNVLPDAT RFHINLRCGG DIAFHLNPRF NENAVVRNTQ INNSWGQEER SLLGRMPFSR GQSFSVWIIC EGHCFKVAVN GQHMCEYYHR LKNLQDINTL EVAGDIQLTH VQT. It is sometimes possible for the material contained within the vial of "Galectin-9 (Lgals9), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.