SDS-PAGE
papillomavirus type 18 L1 Recombinant Protein | L1/HPV18 recombinant protein
Recombinant Human papillomavirus type 18 L1 protein
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
papillomavirus type 18 L1; Recombinant Human papillomavirus type 18 L1 protein; L1/HPV18 recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
358-533aa; Partial
Sequence
GSIVTSDSQLFNKPYWLHKAQGHNNGVCWHNQLFVTVVDTTPSTNLTICASTQSPVPGQYDATKFKQYSRHVEEYDLQFIFQLCTITLTADVMSYIHSMNSSILEDWNFGVPPPPTTSLVDTYRFVQSVAITCQKDAAPAENKDPYDKLKFWNVDLKEKFSLDLDQYPLGRKFLVQ
Sequence Length
568
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for L1/HPV18 recombinant protein
Forms an icosahedral capsid with a T=7 symmetry and about 55 nm diameter. The capsid is composed of 72 pentamers linked to each other by disulfide bonds and associated with L2 proteins. The capsid encapsulates the genomic DNA, but does not bind DNA. Essential for the initial attachment to the host cell.
References
Nucleotide sequence and comparative analysis of the human papillomavirus type 18 genome. Phylogeny of papillomaviruses and repeated structure of the E6 and E7 gene products.Cole S.T., Danos O.J. Mol. Biol. 193:599-608(1987)
Phylogenetic analysis of 48 papillomavirus types and 28 subtypes and variants
a showcase for the molecular evolution of DNA viruses.Chan S.-Y., Bernard H.U., Ong C.K., Chan S.P., Birgit H., Delius H.J. Virol. 66:5714-5725(1992)
Characterization of a transcriptional promoter of human papillomavirus 18 and modulation of its expression by simian virus 40 and adenovirus early antigens.Thierry F., Heard J.-M., Dartmann K., Yaniv M.J. Virol. 61:134-142(1987)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
24.1 kDa
NCBI Official Full Name
L1 protein
NCBI Official Symbol
L1
NCBI Protein Information
major capsid L1 protein
UniProt Protein Name
Major capsid protein L1
UniProt Gene Name
L1
UniProt Entry Name
VL1_HPV18
Uniprot Description
Forms an icosahedral capsid with a T=7 symmetry and a 50 nm diameter. The capsid is composed of 72 pentamers linked to each other by disulfide bonds and associated with L2 proteins. Binds to heparan sulfate proteoglycans on cell surface of basal layer keratinocytes to provide initial virion attachment. This binding mediates a conformational change in the virus capsid that facilitates efficient infection. The virion enters the host cell via endocytosis. During virus trafficking, L1 protein dissociates from the viral DNA and the genomic DNA is released to the host nucleus. The virion assembly takes place within the cell nucleus. Encapsulates the genomic DNA together with protein L2.
Research Articles on L1/HPV18
Similar Products
Product Notes
The L1/HPV18 l1 (Catalog #AAA1265161) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 358-533aa; Partial. The amino acid sequence is listed below: GSIVTSDSQL FNKPYWLHKA QGHNNGVCWH NQLFVTVVDT TPSTNLTICA STQSPVPGQY DATKFKQYSR HVEEYDLQFI FQLCTITLTA DVMSYIHSMN SSILEDWNFG VPPPPTTSLV DTYRFVQSVA ITCQKDAAPA ENKDPYDKLK FWNVDLKEKF SLDLDQYPLG RKFLVQ. It is sometimes possible for the material contained within the vial of "papillomavirus type 18 L1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
