Krueppel-like factor 10 (Klf10) Recombinant Protein | Klf10 recombinant protein
Recombinant Rat Krueppel-like factor 10 (Klf10)
Gene Names
Klf10; Tieg
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Krueppel-like factor 10 (Klf10); Recombinant Rat Krueppel-like factor 10 (Klf10); Klf10 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-480, Full length protein
Sequence
MLNFGASLQQASEGKMELISEKSKEGAHPWDKAEQSDFEAVEALMSMSCDWKSHFKKYLENRPVTPVSDTSEEDSLLPGTPDLQTVPAFCLTPPYSPSDFEPSQGSNLTAPAPPTGHFRSLSDAAKPPSIAPFKEEEKSPLAAPPLPKAQATSVIRHTADAQLCNHQSCPVKAASILNYQDNSFRRRTHINVEATRKNIPCAAVSPNRPKPEPSTAANGAEKAGTAPYDFAVPSSETVICRSSQPAPTSPVQKSVLMSSPTVSTGGVPPLPVICQMVPLPANNSLVTTVVPSSPPSQPPAVCSPVLFMGTQVPKGTVMFVVPQPVVQSPKPPVVSPNGTRLSPIAPAPGFSPSAARVTPQIDSSRVRSHICSHPGCGKTYFKSSHLKAHVRTHTGEKPFSCSWKGCERRFARSDELSRHRRTHTGEKKFACPMCDRRFMRSDHLTKHARRHLSAKKLPNWQMEVSKLNDIALPPATASAQ
Sequence Length
480
Species
Rat
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
51,829 Da
NCBI Official Full Name
Krueppel-like factor 10
NCBI Official Synonym Full Names
Kruppel-like factor 10
NCBI Official Symbol
Klf10
NCBI Official Synonym Symbols
Tieg
NCBI Protein Information
Krueppel-like factor 10
UniProt Protein Name
Krueppel-like factor 10
Protein Family
UniProt Gene Name
Klf10
UniProt Synonym Gene Names
Cpg20; Tieg; Tieg1; TGFB-inducible early growth response protein 1; TIEG-1
NCBI Description
Kruppel-like zinc finger transcription factor; involved in TGFbeta-mediated signaling cascades to the regulation of pancreatic epithelial cell growth [RGD, Feb 2006]
Uniprot Description
Transcriptional repressor which binds to the consensus sequence 5'-GGTGTG-3'. Regulates the circadian expression of genes involved in lipogenesis, gluconeogenesis, and glycolysis in the liver. Represses the expression of PCK2, a rate-limiting step enzyme of gluconeogenesis. May play a role in the cell cycle regulation (). Plays a role in the regulation of the circadian clock; binds to the GC box sequence in the promoter of the core clock component ARTNL/BMAL1 and represses its transcriptional activity.
Research Articles on Klf10
Similar Products
Product Notes
The Klf10 klf10 (Catalog #AAA1205591) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-480, Full length protein. The amino acid sequence is listed below: MLNFGASLQQ ASEGKMELIS EKSKEGAHPW DKAEQSDFEA VEALMSMSCD WKSHFKKYLE NRPVTPVSDT SEEDSLLPGT PDLQTVPAFC LTPPYSPSDF EPSQGSNLTA PAPPTGHFRS LSDAAKPPSI APFKEEEKSP LAAPPLPKAQ ATSVIRHTAD AQLCNHQSCP VKAASILNYQ DNSFRRRTHI NVEATRKNIP CAAVSPNRPK PEPSTAANGA EKAGTAPYDF AVPSSETVIC RSSQPAPTSP VQKSVLMSSP TVSTGGVPPL PVICQMVPLP ANNSLVTTVV PSSPPSQPPA VCSPVLFMGT QVPKGTVMFV VPQPVVQSPK PPVVSPNGTR LSPIAPAPGF SPSAARVTPQ IDSSRVRSHI CSHPGCGKTY FKSSHLKAHV RTHTGEKPFS CSWKGCERRF ARSDELSRHR RTHTGEKKFA CPMCDRRFMR SDHLTKHARR HLSAKKLPNW QMEVSKLNDI ALPPATASAQ. It is sometimes possible for the material contained within the vial of "Krueppel-like factor 10 (Klf10), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
