Killer cell immunoglobulin-like receptor 2DS1 Recombinant Protein | KI2S1 recombinant protein

Recombinant Homo sapiens Killer cell immunoglobulin-like receptor 2DS1

Cat. Num. AAA9422756

• Gene Names: KIR2DS1; p50.1; CD158H; CD158a
• Reactivity: Human
• Purity: Greater than 90% as determined by SDS-PAGE.
• Synonyms: Killer cell immunoglobulin-like receptor 2DS1; Recombinant Homo sapiens Killer cell immunoglobulin-like receptor 2DS1; CD158 antigen-like family member HMHC class I NK cell receptor Eb6 ActI; CD158h; KI2S1 recombinant protein

• Host: Yeast
• Reactivity: Human
• Purity/Purification: Greater than 90% as determined by SDS-PAGE.
• Form/Format: 20mM Tris-HCl based buffer, pH8.0
• Sequence Positions: Full Length of Extracellular Potential domain, 22-245aa
• Sequence: HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMRQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH

• Product Type: Recombinant Protein
• Target Name: KI2S1
• Tag Info: His-tag
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Related Product Information for KI2S1 recombinant protein

Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.

NCBI and Uniprot Product Information

• NCBI GI #: 7657277
• NCBI GeneID: 3806
• NCBI Accession #: NP_055327.1
• NCBI GenBank Nucleotide #: NM_014512.1
• UniProt Accession #: Q14954; O43471
• Molecular Weight: 26.76kD
• NCBI Official Full Name: killer cell immunoglobulin-like receptor 2DS1
• NCBI Official Synonym Full Names: killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 1
• NCBI Official Symbol: KIR2DS1
• NCBI Official Synonym Symbols: p50.1; CD158H; CD158a
• NCBI Protein Information: killer cell immunoglobulin-like receptor 2DS1
• UniProt Protein Name: Killer cell immunoglobulin-like receptor 2DS1
• Protein Family: Killer cell immunoglobulin-like receptor
• UniProt Gene Name: KIR2DS1
• UniProt Synonym Gene Names: CD158H

NCBI Description

Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response. [provided by RefSeq, Jul 2008]

Uniprot Description

KIR2DS1: Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells. Belongs to the immunoglobulin superfamily

Chromosomal Location of Human Ortholog: 19q13.4

Cellular Component: plasma membrane

Biological Process: innate immune response; regulation of immune response