Killer cell immunoglobulin-like receptor 2DS1 Recombinant Protein | KIR2DS1 recombinant protein

Recombinant Human Killer cell immunoglobulin-like receptor 2DS1

Cat. Num. AAA1378970

• Gene Names: KIR2DS1; p50.1; CD158H; CD158a; KIR2DS4; KIR2DP1DL1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Killer cell immunoglobulin-like receptor 2DS1; Recombinant Human Killer cell immunoglobulin-like receptor 2DS1; CD158 antigen-like family member HMHC class I NK cell receptor Eb6 ActI; CD158h; KIR2DS1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 22-245aa; Extracellular Domain
• Sequence: HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMRQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGTFQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH

• Production Note: Special Offer: The Yeast host-expressed protein is manufactured from a stock plasmid containing the protein gene. Yeasthost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The Yeast host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select Yeast host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for KIR2DS1 recombinant protein

Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.

Product Categories/Family for KIR2DS1 recombinant protein

Immunology

References

The human leukocyte antigen (HLA)-C-specific 'activatory' or 'inhibitory' natural killer cell receptors display highly homologous extracellular domains but differ in their transmembrane and intracytoplasmic portions.Biassoni R., Cantoni C., Falco M., Verdiani S., Bottino C., Vitale M., Conte R., Poggi A., Moretta A., Moretta L.J. Exp. Med. 183:645-650(1996) Human diversity in killer cell inhibitory receptor genes.Uhrberg M., Valiante N.M., Shum B.P., Shilling H.G., Lienert-Weidenbach K., Corliss B., Tyan D., Lanier L.L., Parham P.Immunity 7:753-763(1997) The DNA sequence and biology of human chromosome 19.Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V., Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.Nature 428:529-535(2004)

NCBI and Uniprot Product Information

• NCBI GI #: 7657277
• NCBI GeneID: 3806
• NCBI Accession #: NP_055327.1
• NCBI GenBank Nucleotide #: NM_014512.1
• UniProt Accession #: Q14954; O43471
• Molecular Weight: 26.8 kDa
• NCBI Official Full Name: killer cell immunoglobulin-like receptor 2DS1
• NCBI Official Synonym Full Names: killer cell immunoglobulin like receptor, two Ig domains and short cytoplasmic tail 1
• NCBI Official Symbol: KIR2DS1
• NCBI Official Synonym Symbols: p50.1; CD158H; CD158a; KIR2DS4; KIR2DP1DL1
• NCBI Protein Information: killer cell immunoglobulin-like receptor 2DS1
• UniProt Protein Name: Killer cell immunoglobulin-like receptor 2DS1
• Protein Family: Killer cell immunoglobulin-like receptor
• UniProt Gene Name: KIR2DS1
• UniProt Synonym Gene Names: CD158H
• UniProt Entry Name: KI2S1_HUMAN

NCBI Description

Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response. [provided by RefSeq, Jul 2008]

Uniprot Description

KIR2DS1: Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells. Belongs to the immunoglobulin superfamily

Chromosomal Location of Human Ortholog: 19q13.4

Cellular Component: integral to membrane; plasma membrane

Molecular Function: transmembrane receptor activity

Biological Process: immune response; innate immune response; regulation of immune response; signal transduction