Probable 3-ketoacyl-CoA synthase 14 (KCS14) Recombinant Protein | KCS14 recombinant protein
Recombinant Arabidopsis thaliana Probable 3-ketoacyl-CoA synthase 14 (KCS14)
Gene Names
KCS14; 3-ketoacyl-CoA synthase 14; KCS14
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Probable 3-ketoacyl-CoA synthase 14 (KCS14); Recombinant Arabidopsis thaliana Probable 3-ketoacyl-CoA synthase 14 (KCS14); KCS14 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
26-459aa; full length protein
Sequence
LHFHHDFFSPFPVKIGLLLISIFFYAYSTTRSKPVYLVDFSCHQPTDSCKISSETFFNMA KGAQLYTEETIQFMTRILNRSGLGDDTYSPRCMLTSPPTPSMYEARHESELVIFGALNSL FKKTGIEPREVGIFIVNCSLFNPNPSLSSMIVNRYKLKTDVKTYNLSGISVDLATNLLKA NPNTYAVIVSTENMTLSMYRGNDRSMLVPNCLFRVGGAAVMLSNRSQDRVRSKYELTHIV RTHKGSSDKHYTCAEQKEDSKGIVGVALSKELTVVAGDTLKTNLTALGPLVLPLSEKLRF ILFLVKSKLFRLKVSPYVPDFKLCFKHFCIHAGGRALLDAVEKGLGLSEFDLEPSRMTLH RFGNTSSSSLWYELAYVEAKCRVKRGDRVWQLAFGSGFKCNSIVWRALRTIPANESLVGN PWGDSVHKYPVHVT
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for KCS14 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51,626 Da
NCBI Official Full Name
3-ketoacyl-CoA synthase 14
NCBI Official Symbol
KCS14
NCBI Official Synonym Symbols
3-ketoacyl-CoA synthase 14; KCS14
NCBI Protein Information
3-ketoacyl-CoA synthase 14
UniProt Protein Name
Probable 3-ketoacyl-CoA synthase 14
Protein Family
UniProt Gene Name
KCS14
UniProt Synonym Gene Names
VLCFA condensing enzyme 14
UniProt Entry Name
KCS14_ARATH
NCBI Description
Encodes KCS14, a member of the 3-ketoacyl-CoA synthase family involved in the biosynthesis of VLCFA (very long chain fatty acids).
Similar Products
Product Notes
The KCS14 kcs14 (Catalog #AAA7017818) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 26-459aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the KCS14 kcs14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LHFHHDFFSP FPVKIGLLLI SIFFYAYSTT RSKPVYLVDF SCHQPTDSCK ISSETFFNMA KGAQLYTEET IQFMTRILNR SGLGDDTYSP RCMLTSPPTP SMYEARHESE LVIFGALNSL FKKTGIEPRE VGIFIVNCSL FNPNPSLSSM IVNRYKLKTD VKTYNLSGIS VDLATNLLKA NPNTYAVIVS TENMTLSMYR GNDRSMLVPN CLFRVGGAAV MLSNRSQDRV RSKYELTHIV RTHKGSSDKH YTCAEQKEDS KGIVGVALSK ELTVVAGDTL KTNLTALGPL VLPLSEKLRF ILFLVKSKLF RLKVSPYVPD FKLCFKHFCI HAGGRALLDA VEKGLGLSEF DLEPSRMTLH RFGNTSSSSL WYELAYVEAK CRVKRGDRVW QLAFGSGFKC NSIVWRALRT IPANESLVGN PWGDSVHKYP VHVT. It is sometimes possible for the material contained within the vial of "Probable 3-ketoacyl-CoA synthase 14 (KCS14), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
