Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Intermediate conductance calcium-activated potassium channel protein 4 (KCNN4) Recombinant Protein | KCNN4 recombinant protein

Recombinant Human Intermediate conductance calcium-activated potassium channel protein 4 (KCNN4), partial

Gene Names
KCNN4; IK; IK1; SK4; DHS2; KCA4; hSK4; IKCA1; hKCa4; KCa3.1; hIKCa1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Intermediate conductance calcium-activated potassium channel protein 4 (KCNN4); Recombinant Human Intermediate conductance calcium-activated potassium channel protein 4 (KCNN4); partial; KCNN4 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
285-427. Partial.
Sequence
VARKLEFNKAEKHVHNFMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESHAARRHQRKLLAAINAFRQVRLKHRKLREQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALTELLSTALGPRQLPEPSQQSK
Sequence Length
427
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,696 Da
NCBI Official Full Name
intermediate conductance calcium-activated potassium channel protein 4
NCBI Official Synonym Full Names
potassium calcium-activated channel subfamily N member 4
NCBI Official Symbol
KCNN4
NCBI Official Synonym Symbols
IK; IK1; SK4; DHS2; KCA4; hSK4; IKCA1; hKCa4; KCa3.1; hIKCa1
NCBI Protein Information
intermediate conductance calcium-activated potassium channel protein 4
UniProt Protein Name
Intermediate conductance calcium-activated potassium channel protein 4
UniProt Gene Name
KCNN4
UniProt Synonym Gene Names
IK1; IKCA1; KCA4; SK4; SK4; SKCa 4; SKCa4; IK1

NCBI Description

The protein encoded by this gene is part of a potentially heterotetrameric voltage-independent potassium channel that is activated by intracellular calcium. Activation is followed by membrane hyperpolarization, which promotes calcium influx. The encoded protein may be part of the predominant calcium-activated potassium channel in T-lymphocytes. This gene is similar to other KCNN family potassium channel genes, but it differs enough to possibly be considered as part of a new subfamily. [provided by RefSeq, Jul 2008]

Uniprot Description

Forms a voltage-independent potassium channel that is activated by intracellular calcium (PubMed:26148990). Activation is followed by membrane hyperpolarization which promotes calcium influx. Required for maximal calcium influx and proliferation during the reactivation of naive T-cells. The channel is blocked by clotrimazole and charybdotoxin but is insensitive to apamin (PubMed:17157250, PubMed:18796614).

Research Articles on KCNN4

Similar Products

Product Notes

The KCNN4 kcnn4 (Catalog #AAA7055195) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 285-427. Partial. The amino acid sequence is listed below: VARKLEFNKA EKHVHNFMMD IQYTKEMKES AARVLQEAWM FYKHTRRKES HAARRHQRKL LAAINAFRQV RLKHRKLREQ VNSMVDISKM HMILYDLQQN LSSSHRALEK QIDTLAGKLD ALTELLSTAL GPRQLPEPSQ QSK . It is sometimes possible for the material contained within the vial of "Intermediate conductance calcium-activated potassium channel protein 4 (KCNN4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.