G protein-activated inward rectifier potassium channel 4 (KCNJ5) Recombinant Protein | KCNJ5 recombinant protein
Recombinant Pig G protein-activated inward rectifier potassium channel 4 (KCNJ5)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
G protein-activated inward rectifier potassium channel 4 (KCNJ5); Recombinant Pig G protein-activated inward rectifier potassium channel 4 (KCNJ5); KCNJ5 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-419
Sequence
MAGDSRNAMNQDMEIGVTPRDPKKIPKQARDYIPIATDRTRLLAEGKKPRQRYMEKSGKCNVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTVTWLFFGFIWWLIAYIRGDLDHVGDQEWIPCVENLSGFVSAFLFSIETETTIGYGFRVITEKCPEGIVLLLVQAILGSIVNAFMVGCMFVKISQPKKRAETLMFSNHAVISLRDEKLCLMFRVGDLRNSHIVEASIRAKLIKSRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEINEKSPFWEMSRAQLNQEEFEVVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNTFHDTYETNTPSCCAKELAEMKREGRLLQYLPSPPLPGGCAGAELEAEAEQEGEDEPEGLRGSRETRDSV
Sequence Length
419
Species
Sus scrofa (Pig)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Related Product Information for KCNJ5 recombinant protein
KCNJ5
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,778 Da
NCBI Official Full Name
G protein-activated inward rectifier potassium channel 4
NCBI Official Symbol
KCNJ5
NCBI Protein Information
G protein-activated inward rectifier potassium channel 4; CIR; GIRK-4; KATP-1; heart KATP channel; cardiac inward rectifier; inward rectifying K channel; inward rectifier K(+) channel Kir3.4; potassium channel, inwardly rectifying subfamily J member 5
UniProt Protein Name
G protein-activated inward rectifier potassium channel 4
Protein Family
UniProt Gene Name
KCNJ5
UniProt Synonym Gene Names
GIRK-4; CIR
UniProt Entry Name
IRK5_PIG
Uniprot Description
Function: This potassium channel is controlled by G proteins. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by external barium.
Subunit structure: May associate with GIRK1 and GIRK2 to form a G-protein-activated heteromultimer pore-forming unit. The resulting inward current is much larger
By similarity.
Subcellular location: Membrane; Multi-pass membrane protein.
Sequence similarities: Belongs to the inward rectifier-type potassium channel (TC 1.A.2.1) family. KCNJ5 subfamily. [View classification]
Research Articles on KCNJ5
Similar Products
Product Notes
The KCNJ5 kcnj5 (Catalog #AAA1156127) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-419. The amino acid sequence is listed below: MAGDSRNAMN QDMEIGVTPR DPKKIPKQAR DYIPIATDRT RLLAEGKKPR QRYMEKSGKC NVHHGNVQET YRYLSDLFTT LVDLKWRFNL LVFTMVYTVT WLFFGFIWWL IAYIRGDLDH VGDQEWIPCV ENLSGFVSAF LFSIETETTI GYGFRVITEK CPEGIVLLLV QAILGSIVNA FMVGCMFVKI SQPKKRAETL MFSNHAVISL RDEKLCLMFR VGDLRNSHIV EASIRAKLIK SRQTKEGEFI PLNQTDINVG FDTGDDRLFL VSPLIISHEI NEKSPFWEMS RAQLNQEEFE VVVILEGMVE ATGMTCQARS SYMDTEVLWG HRFTPVLTLE KGFYEVDYNT FHDTYETNTP SCCAKELAEM KREGRLLQYL PSPPLPGGCA GAELEAEAEQ EGEDEPEGLR GSRETRDSV. It is sometimes possible for the material contained within the vial of "G protein-activated inward rectifier potassium channel 4 (KCNJ5), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
