Rhombotin-1 Recombinant Protein | LMO1 recombinant protein

Recombinant human Rhombotin-1

Cat. Num. AAA717389

• Gene Names: LMO1; TTG1; RBTN1; RHOM1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Rhombotin-1; Recombinant human Rhombotin-1; LMO1 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence: MVLDKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGQLNGTFESQVQ

• Preparation and Storage: Store at -20 degree C. For extended storage, conserve at -20 or -80 degree C.

SDS-PAGE

NCBI and Uniprot Product Information

• NCBI GI #: 394025675
• NCBI GeneID: 4004
• NCBI Accession #: NP_001257357.1
• NCBI GenBank Nucleotide #: NM_001270428.1
• UniProt Accession #: P25800; Q4VBC5
• Molecular Weight: 44 KD
• NCBI Official Full Name: rhombotin-1 isoform b
• NCBI Official Synonym Full Names: LIM domain only 1 (rhombotin 1)
• NCBI Official Symbol: LMO1
• NCBI Official Synonym Symbols: TTG1; RBTN1; RHOM1
• NCBI Protein Information: rhombotin-1; LMO-1; LIM domain only protein 1; T-cell translocation gene 1; cysteine-rich protein TTG-1; T-cell translocation protein 1
• UniProt Protein Name: Rhombotin-1
• Protein Family: Rhombotin
• UniProt Gene Name: LMO1
• UniProt Synonym Gene Names: RBTN1; RHOM1; TTG1; LMO-1
• UniProt Entry Name: RBTN1_HUMAN

NCBI Description

This locus encodes a transcriptional regulator that contains two cysteine-rich LIM domains but lacks a DNA-binding domain. LIM domains may play a role in protein interactions; thus the encoded protein may regulate transcription by competitively binding to specific DNA-binding transcription factors. Alterations at this locus have been associated with acute lymphoblastic T-cell leukemia. Chromosomal rearrangements have been observed between this locus and at least two loci, the delta subunit of the T-cell antigen receptor gene and the LIM domain binding 1 gene. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jul 2012]

Uniprot Description

Function: May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors. Ref.3

Subcellular location: Nucleus

By similarity.

Tissue specificity: Expressed mainly in the central nervous. Low level of expression in other tissues including thymus. Ref.7

Involvement in disease: Note=A chromosomal aberration involving LMO1 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(11,14)(p15;q11) with TCRD.

Sequence similarities: Contains 2 LIM zinc-binding domains.