Potassium channel KAT3 (KAT3) Recombinant Protein | KAT3 recombinant protein
Recombinant Arabidopsis thaliana Potassium channel KAT3 (KAT3)
Gene Names
KAT3; A. thaliana low-K+-tolerant 1; ARABIDOPSIS THALIANA K+ RECTIFYING CHANNEL 1; ATKC1; AtLKT1; F4D11.150; F4D11_150; K+ INWARD RECTIFYING CHANNEL PROTEIN; KAT3; KC1; potassium channel in Arabidopsis thaliana 3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Potassium channel KAT3 (KAT3); Recombinant Arabidopsis thaliana Potassium channel KAT3 (KAT3); KAT3 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-662aa; full length protein
Sequence
MSTTTTEARSPLPLLLRRGRSSTALSASTAEARSPLSILQFRRRSSKDVRNITSVSSSLL PAFGTFIEDDNPSSKPFIVLHFDRRYRLWELFLVILVGYSAWASLFELAFEKAAEGALLT IDLVVDFFFAVDIILTFFVSYLDNTTYLNVTDHKLIAKRYLKSVAFVMDVASTLPIQFIY KTITGDVGRGQAFGFLNLLRLWRLRRVAELFKRLEKDAHFNYFVIRVIKLLCVTIFWIHL AGCILYWIAYHYPRPTDTWIGSQVEDFKERSVWLGYTYSMYWSIVTLTTVGYGDLHAVNS REKTFNMFYMLFNIGLTSYIIGIMTNLVVHGALRTFAMRSAINDILRYTSKNRLPDTMRE QMLAHMQLKFKTAELRQEEVLQDLPKAIRSSINQHLFRSIIEEAYLFKGFPEGLLVQLVS QIQAEYFPPKMEIILQNEIPTDFYVIVSGGVDIIASKGVSEQVLAKLGPGSMAGEIGVVF NIPQPFTVRTRRLSQVIRIGHHKFKEMVQSDNDVDAKMIIANFMTYLKGLNDELKKEIPF LRDLLDDADAQVQETVQSEETPQSNDEEIVTVSRHENGQIEERRREGVPKRVIIHGQAPP NQDNKNNGDSNGRLIILPDSIQLLFDLAEKKLGKRGSTIAMADGAHVEQIDALRENDHLY IF
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Arabidopsis thaliana (Mouse-ear cress)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for KAT3 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75,598 Da
NCBI Official Full Name
potassium channel KAT3
NCBI Official Symbol
KAT3
NCBI Official Synonym Symbols
A. thaliana low-K+-tolerant 1; ARABIDOPSIS THALIANA K+ RECTIFYING CHANNEL 1; ATKC1; AtLKT1; F4D11.150; F4D11_150; K+ INWARD RECTIFYING CHANNEL PROTEIN; KAT3; KC1; potassium channel in Arabidopsis thaliana 3
NCBI Protein Information
potassium channel KAT3
UniProt Protein Name
Potassium channel KAT3
UniProt Gene Name
KAT3
UniProt Synonym Gene Names
AKT4; KC1
UniProt Entry Name
KAT3_ARATH
NCBI Description
Encodes KAT3, a member of the Shaker family of voltage-gated potassium channel subunits. Does not form functional potassium channel on its own. Involved in down-regulating AKT1 and KAT1 channel activity by forming heteromers with AKT1 or KAT1. The Shaker family K+ ion channels include five groups based on phylogenetic analysis (FEBS Letters (2007) 581: 2357): I (inwardly rectifying conductance): AKT1 (AT2G26650), AKT5 (AT4G32500) and SPIK (also known as AKT6, AT2G25600); II (inward rectifying channel): KAT1 (AT5G46240) and KAT2 (AT4G18290); III (weakly inward rectifying channel): AKT2 (AT4G22200); IV (regulatory subunit involved in inwardly rectifying conductance formation): KAT3 (also known as AtKC1, AT4G32650); V (outward rectifying channel): SKOR (AT3G02850) and GORK (AT5G37500).
Uniprot Description
Probable modulatory (alpha) subunit of inward-rectifying potassium channels. Could mediate potassium uptake from the soil solution by plant roots in association with AKT1.
Research Articles on KAT3
Similar Products
Product Notes
The KAT3 kat3 (Catalog #AAA7017593) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-662aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the KAT3 kat3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSTTTTEARS PLPLLLRRGR SSTALSASTA EARSPLSILQ FRRRSSKDVR NITSVSSSLL PAFGTFIEDD NPSSKPFIVL HFDRRYRLWE LFLVILVGYS AWASLFELAF EKAAEGALLT IDLVVDFFFA VDIILTFFVS YLDNTTYLNV TDHKLIAKRY LKSVAFVMDV ASTLPIQFIY KTITGDVGRG QAFGFLNLLR LWRLRRVAEL FKRLEKDAHF NYFVIRVIKL LCVTIFWIHL AGCILYWIAY HYPRPTDTWI GSQVEDFKER SVWLGYTYSM YWSIVTLTTV GYGDLHAVNS REKTFNMFYM LFNIGLTSYI IGIMTNLVVH GALRTFAMRS AINDILRYTS KNRLPDTMRE QMLAHMQLKF KTAELRQEEV LQDLPKAIRS SINQHLFRSI IEEAYLFKGF PEGLLVQLVS QIQAEYFPPK MEIILQNEIP TDFYVIVSGG VDIIASKGVS EQVLAKLGPG SMAGEIGVVF NIPQPFTVRT RRLSQVIRIG HHKFKEMVQS DNDVDAKMII ANFMTYLKGL NDELKKEIPF LRDLLDDADA QVQETVQSEE TPQSNDEEIV TVSRHENGQI EERRREGVPK RVIIHGQAPP NQDNKNNGDS NGRLIILPDS IQLLFDLAEK KLGKRGSTIA MADGAHVEQI DALRENDHLY IF. It is sometimes possible for the material contained within the vial of "Potassium channel KAT3 (KAT3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
