Rabbit ACTN3 Polyclonal Antibody | anti-ACTN3 antibody

Anti-ACTN3 Antibody

Cat. Num. AAA178782

• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen affinity purified.
• Synonyms: ACTN3; Polyclonal Antibody; Anti-ACTN3 Antibody; Actinin alpha 3; Alpha-Actinin 3; Alpha-actinin-3; ACTN 3; Q08043; actinin alpha 3 (gene/pseudogene); anti-ACTN3 antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Immunogen affinity purified.
• Form/Format: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 901

• Applicable Applications for anti-ACTN3 antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot: 0.1-0.5ug/ml; Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml
• Notes: Tested Species: In-house tested species with positive results.; By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.; Other applications have not been tested.
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ACTN3 (574-617aa EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINT K), different from the related mouse sequence by five amino acids.
• Preparation and Storage: Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of ACTN3 expression in rat skeletal muscle extract (lane 1), mouse skeletal muscle extract (lane 2) and HT080 whole cell lysates (lane 3). ACTN3 at 103KD was detected using rabbit anti- ACTN3 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Immunohistochemistry (IHC)

(ACTN3 was detected in paraffin-embedded sections of mouse skeletal muscle tissues using rabbit anti- ACTN3 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(ACTN3 was detected in paraffin-embedded sections of rat skeletal muscle tissues using rabbit anti- ACTN3 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method. )

Immunohistochemistry (IHC)

(ACTN3 was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- ACTN3 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Related Product Information for anti-ACTN3 antibody

Rabbit IgG polyclonal antibody for Alpha-actinin-3(ACTN3) detection.
Background: Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status.

References

1. Papadimitriou ID, Papadopoulos C, Kouvatsi A, Triantaphyllidis C (April 2008). "The ACTN3 gene in elite Greek track and field athletes". Int J Sports Med 29 (4): 352-5.
2. Yang N, MacArthur DG, Gulbin JP, Hahn AG, Beggs AH, Easteal S, North K (September 2003). "ACTN3 genotype is associated with human elite athletic performance". Am. J. Hum. Genet. 73 (3): 627-31.

NCBI and Uniprot Product Information

• NCBI GI #: 585866354
• NCBI GeneID: 89
• NCBI Accession #: NP_001095.2
• NCBI GenBank Nucleotide #: NM_001104.3
• UniProt Accession #: Q08043; Q4KKV2; A6NP77
• Molecular Weight: 103,241 Da
• NCBI Official Full Name: alpha-actinin-3 isoform 1
• NCBI Official Synonym Full Names: actinin alpha 3 (gene/pseudogene)
• NCBI Official Symbol: ACTN3
• NCBI Protein Information: alpha-actinin-3
• UniProt Protein Name: Alpha-actinin-3
• Protein Family: Alpha-actinin
• UniProt Gene Name: ACTN3

NCBI Description

This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status. [provided by RefSeq, Feb 2014]

Uniprot Description

ACTN3: F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein. Belongs to the alpha-actinin family.

Protein type: Cytoskeletal; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 11q13.2

Cellular Component: actin filament; cytosol; focal adhesion; intracellular; pseudopodium

Molecular Function: integrin binding; protein binding; protein homodimerization activity; structural constituent of muscle

Biological Process: focal adhesion formation; muscle filament sliding; negative regulation of glycolysis; positive regulation of skeletal muscle growth; regulation of the force of skeletal muscle contraction; response to denervation involved in regulation of muscle adaptation; skeletal muscle atrophy; transition between fast and slow fiber