Junctional adhesion molecule B Recombinant Protein | JAM2 recombinant protein

Recombinant Human Junctional adhesion molecule B

Cat. Num. AAA965190

• Gene Names: JAM2; JAMB; CD322; JAM-B; VEJAM; PRO245; VE-JAM; C21orf43
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Junctional adhesion molecule B; Recombinant Human Junctional adhesion molecule B; Junctional adhesion molecule 2; JAM-2; Vascular endothelial junction-associated molecule; VE-JAM; CD322; JAM2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 29-238aa; Extracellular Domain
• Sequence: FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNIS
• Sequence Length: 262

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for JAM2 recombinant protein

May play a role in the processes of lymphocyte homing to secondary lymphoid organs.

Product Categories/Family for JAM2 recombinant protein

Cardiovascular

References

Vascular endothelial junction-associated molecule, a novel member of the immunoglobulin superfamily, is localized to intercellular boundaries of endothelial cells.Palmeri D., van Zante A., Huang C.-C., Hemmerich S., Rosen S.D.J. Biol. Chem. 275:19139-19145(2000) A novel protein with homology to the junctional adhesion molecule Characterization of leukocyte interactions.Cunningham S.A., Arrate M.P., Rodriguez J.M., Bjercke R.J., Vanderslice P., Morris A.P., Brock T.A.J. Biol. Chem. 275:34750-34756(2000) Annotation of human chromosome 21 for relevance to Down syndrome gene structure and expression analysis.Gardiner K., Slavov D., Bechtel L., Davisson M.Genomics 79:833-843(2002) The secreted protein discovery initiative (SPDI) , a large-scale effort to identify novel human secreted and transmembrane proteins a bioinformatics assessment.Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.Genome Res. 13:2265-2270(2003) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004) The DNA sequence of human chromosome 21.Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A., Menzel U., Delabar J., Kumpf K., Lehmann R., Patterson D., Reichwald K., Rump A., Schillhabel M., Schudy A., Zimmermann W., Rosenthal A., Kudoh J., Shibuya K., Kawasaki K., Asakawa S., Shintani A., Sasaki T., Nagamine K., Mitsuyama S., Antonarakis S.E., Minoshima S., Shimizu N., Nordsiek G., Hornischer K., Brandt P., Scharfe M., Schoen O., Desario A., Reichelt J., Kauer G., Bloecker H., Ramser J., Beck A., Klages S., Hennig S., Riesselmann L., Dagand E., Wehrmeyer S., Borzym K., Gardiner K., Nizetic D., Francis F., Lehrach H., Reinhardt R., Yaspo M.-L.Nature 405:311-319(2000) Signal peptide prediction based on analysis of experimentally verified cleavage sites.Zhang Z., Henzel W.J.Protein Sci. 13:2819-2824(2004) Cloning of human junctional adhesion molecule 3 (JAM3) and its identification as the JAM2 counter-receptor.Arrate M.P., Rodriguez J.M., Tran T.M., Brock T.A., Cunningham S.A.J. Biol. Chem. 276:45826-45832(2001) Leukocyte-endothelial-cell interactions in leukocyte transmigration and the inflammatory response.Muller W.A.Trends Immunol. 24:327-334(2003) Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D.J. Proteome Res. 4:2070-2080(2005)

NCBI and Uniprot Product Information

• NCBI GI #: 393715111
• NCBI GeneID: 58494
• NCBI Accession #: NP_001257336.1
• NCBI GenBank Nucleotide #: NM_001270407.1
• UniProt Accession #: P57087; Q6UXG6; Q6YNC1; B2R6T9; B4DGT9
• Molecular Weight: 25.5 kDa
• NCBI Official Full Name: junctional adhesion molecule B isoform 2
• NCBI Official Synonym Full Names: junctional adhesion molecule 2
• NCBI Official Symbol: JAM2
• NCBI Official Synonym Symbols: JAMB; CD322; JAM-B; VEJAM; PRO245; VE-JAM; C21orf43
• NCBI Protein Information: junctional adhesion molecule B
• UniProt Protein Name: Junctional adhesion molecule B
• Protein Family: Junctional adhesion molecule
• UniProt Gene Name: JAM2
• UniProt Synonym Gene Names: C21orf43; VEJAM; JAM-B; JAM-2; VE-JAM
• UniProt Entry Name: JAM2_HUMAN

NCBI Description

This gene belongs to the immunoglobulin superfamily, and the junctional adhesion molecule (JAM) family. The protein encoded by this gene is a type I membrane protein that is localized at the tight junctions of both epithelial and endothelial cells. It acts as an adhesive ligand for interacting with a variety of immune cell types, and may play a role in lymphocyte homing to secondary lymphoid organs. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2012]

Uniprot Description

JAM2: May play a role in the processes of lymphocyte homing to secondary lymphoid organs. Belongs to the immunoglobulin superfamily.

Protein type: Membrane protein, integral; Cell adhesion

Chromosomal Location of Human Ortholog: 21q21.2

Cellular Component: integral to plasma membrane; plasma membrane; tight junction

Molecular Function: protein binding; protein heterodimerization activity

Biological Process: blood coagulation; cell-cell adhesion; extracellular matrix organization and biogenesis; leukocyte migration; negative regulation of cell adhesion