Zinc finger protein JAGGED (JAG) Recombinant Protein | JAG recombinant protein

Recombinant Arabidopsis thaliana Zinc finger protein JAGGED (JAG)

Cat. Num. AAA1425379

• Gene Names: JAG; JAGGED; T26J14.5; T26J14_5
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Zinc finger protein JAGGED (JAG); Recombinant Arabidopsis thaliana Zinc finger protein JAGGED (JAG); JAG recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-253, Full length protein
• Sequence: MRHEENYLDLNNLPDDFSKDGNKQALEEGSSSGQRKKKGSKEGKDESGKVYECRFCSLKFCKSQALGGHMNRHRQERETETLNQARQLVYRNDTITPPGISPFGYHHTTDPTIYRSVYSSPMIYPGSSSTNLVPQPPMPPPPPPYPYSSNQYSPHNHFNDYYLNPSFRGSRSISPSPNLPTTTTVDYMADSPVEPGYTCVGAPIGPTGFPIRGPSIVRAPLEPPQGRDGDASRQRLDHSLRFPINRFQDHHSL
• Sequence Length: 253

• Species: Arabidopsis thaliana (Mouse-ear cress)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 79375919
• NCBI GeneID: 843177
• NCBI Accession #: NP_177015.3
• NCBI GenBank Nucleotide #: NM_105519.4
• UniProt Accession #: Q6S591; Q9CA33
• Molecular Weight: 28,379 Da
• NCBI Official Full Name: C2H2 and C2HC zinc fingers superfamily protein
• NCBI Official Symbol: JAG
• NCBI Official Synonym Symbols: JAGGED; T26J14.5; T26J14_5
• NCBI Protein Information: C2H2 and C2HC zinc fingers superfamily protein
• UniProt Protein Name: Zinc finger protein JAGGED
• Protein Family: Zinc finger protein
• UniProt Gene Name: JAG

NCBI Description

Encodes a putative zinc finger transcription factor that is necessary for proper lateral organ shape and is sufficient to induce the proliferation of lateral organ tissue. Together with NUB, it is involved in stamen and carpel development.

Uniprot Description

Controls the morphogenesis of lateral organs. Functions in lateral organ shape and is sufficient to induce proliferation and growth of lateral organ tissue. Is necessary and sufficient for bract formation, but its expression is excluded from the cryptic bract, which could be a cause of bractless flowers in Arabidopsis. Participates with FIL and YAB3 in regulating valve margin development. Functions with JGL to define stamen and carpel shape. Functions with AS1 and AS2 in the sepal and petal primordia to repress boundary-specifying genes for normal development of the organs.