Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4) Recombinant Protein | ITIH4 recombinant protein
Recombinant Pig Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4), partial
Gene Names
ITIH4; IHRP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4); Recombinant Pig Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4); partial; ITIH4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
756-921; Partial
Sequence
QGVEVTGHYEREKARFSWIEVTFKHPPLQVRASLEHIVVIRNRQSSAYKWKETLYSVMPGLKITMDKAGLLLLSSPNRVTIGLLSWDGPGKGLRLLLRDTDHFSSQISGTFGQFYQDVVWGPPAAADDSKRTVTVQGHDHSATRELKLDYQEGSPGKEISCWTVVL
Sequence Length
921
Species
Sus scrofa (Pig)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for ITIH4 recombinant protein
This protein is secreted into the blood, where it is cleaved by plasma kallikrein into two smaller forms. Expression of this gene has been detected only in liver, and it seems to be upregulated during surgical trauma. This gene is part of a cluster of similar genes on chromosome 3. Two transcript variants encoding different isoforms have been found for this gene.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
102,146 Da
NCBI Official Full Name
inter-alpha-trypsin inhibitor heavy chain H4
NCBI Official Symbol
ITIH4
NCBI Official Synonym Symbols
IHRP
NCBI Protein Information
inter-alpha-trypsin inhibitor heavy chain H4
UniProt Protein Name
Inter-alpha-trypsin inhibitor heavy chain H4
Protein Family
UniProt Gene Name
ITIH4
UniProt Synonym Gene Names
IHRP; ITI heavy chain H4; ITI-HC4; Inter-alpha-inhibitor heavy chain 4; IHRP; MAP
Uniprot Description
Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration.
Research Articles on ITIH4
Similar Products
Product Notes
The ITIH4 itih4 (Catalog #AAA953263) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 756-921; Partial. The amino acid sequence is listed below: QGVEVTGHYE REKARFSWIE VTFKHPPLQV RASLEHIVVI RNRQSSAYKW KETLYSVMPG LKITMDKAGL LLLSSPNRVT IGLLSWDGPG KGLRLLLRDT DHFSSQISGT FGQFYQDVVW GPPAAADDSK RTVTVQGHDH SATRELKLDY QEGSPGKEIS CWTVVL . It is sometimes possible for the material contained within the vial of "Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
