Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Integrin beta-8 Recombinant Protein | ITGB8 recombinant protein

Integrin beta-8

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Integrin beta-8; ITGB8 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
43-769aa; full length protein
Sequence
EDNRCASSNAASCARCLALGPECGWCVQEDFISGGSRSERCDIVSNLISKGCSVDSIEYPSVHVIIPTENEINTQVTPGEVSIQLRPGAEANFMLKVHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAFFSRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKAVHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVVPNDGNCHLKNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGTIAGEIESKAANLNNLVVEAYQKLISEVKVQVENQVQGIYFNITAICPDGSRKPGMEGCRNVTSNDEVLFNVTVTMKKCDVTGGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGPKGKCVDETFLDSKCFQCDENKCHFDEDQFSSESCKSHKDQPVCSGRGVCVCGKCSCHKIKLGKVYGKYCEKDDFSCPYHHGNLCAGHGECEAGRCQCFSGWEGDRCQCPSAAAQHCVNSKGQVCSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCALMEQQHYVDQTSECFSSPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWNSNKIKSSSDYRVSASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAHETFRCNF
Sequence Length
Full Length Protein
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for ITGB8 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for ITGB8 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71,284 Da
NCBI Official Full Name
integrin beta-8
NCBI Official Synonym Full Names
integrin subunit beta 8
NCBI Official Symbol
ITGB8
NCBI Protein Information
integrin beta-8
UniProt Protein Name
Integrin beta-8
Protein Family
UniProt Gene Name
ITGB8
UniProt Entry Name
ITB8_HUMAN

NCBI Description

This gene is a member of the integrin beta chain family and encodes a single-pass type I membrane protein with a VWFA domain and four cysteine-rich repeats. This protein noncovalently binds to an alpha subunit to form a heterodimeric integrin complex. In general, integrin complexes mediate cell-cell and cell-extracellular matrix interactions and this complex plays a role in human airway epithelial proliferation. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

ITGB8: Integrin alpha-V/beta-8 is a receptor for fibronectin. Belongs to the integrin beta chain family.

Protein type: Motility/polarity/chemotaxis; Cell adhesion; Membrane protein, integral

Chromosomal Location of Human Ortholog: 7p21.1

Cellular Component: cell surface; integrin complex; plasma membrane

Biological Process: cartilage development; cell adhesion; cell-matrix adhesion; extracellular matrix organization and biogenesis

Research Articles on ITGB8

Similar Products

Product Notes

The ITGB8 itgb8 (Catalog #AAA7042964) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 43-769aa; full length protein. The amino acid sequence is listed below: EDNRCASSNA ASCARCLALG PECGWCVQED FISGGSRSER CDIVSNLISK GCSVDSIEYP SVHVIIPTEN EINTQVTPGE VSIQLRPGAE ANFMLKVHPL KKYPVDLYYL VDVSASMHNN IEKLNSVGND LSRKMAFFSR DFRLGFGSYV DKTVSPYISI HPERIHNQCS DYNLDCMPPH GYIHVLSLTE NITEFEKAVH RQKISGNIDT PEGGFDAMLQ AAVCESHIGW RKEAKRLLLV MTDQTSHLAL DSKLAGIVVP NDGNCHLKNN VYVKSTTMEH PSLGQLSEKL IDNNINVIFA VQGKQFHWYK DLLPLLPGTI AGEIESKAAN LNNLVVEAYQ KLISEVKVQV ENQVQGIYFN ITAICPDGSR KPGMEGCRNV TSNDEVLFNV TVTMKKCDVT GGKNYAIIKP IGFNETAKIH IHRNCSCQCE DNRGPKGKCV DETFLDSKCF QCDENKCHFD EDQFSSESCK SHKDQPVCSG RGVCVCGKCS CHKIKLGKVY GKYCEKDDFS CPYHHGNLCA GHGECEAGRC QCFSGWEGDR CQCPSAAAQH CVNSKGQVCS GRGTCVCGRC ECTDPRSIGR FCEHCPTCYT ACKENWNCMQ CLHPHNLSQA ILDQCKTSCA LMEQQHYVDQ TSECFSSPSY LRIFFIIFIV TFLIGLLKVL IIRQVILQWN SNKIKSSSDY RVSASKKDKL ILQSVCTRAV TYRREKPEEI KMDISKLNAH ETFRCNF. It is sometimes possible for the material contained within the vial of "Integrin beta-8, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.