Integrin beta-2 (Itgb2) Recombinant Protein | Itgb2 recombinant protein

Recombinant Mouse Integrin beta-2 (Itgb2), partial

Cat. Num. AAA958512

• Gene Names: Itgb2; 2E6; LAD; Cd18; Lfa1; MF17; LCAMB; AI528527
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Integrin beta-2 (Itgb2); Recombinant Mouse Integrin beta-2 (Itgb2); partial; Itgb2 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 24-702. Partial, provide the complete extracellular domain.
• Sequence: QECTKYKVSSCRDCIQSGPGCSWCQKLNFTGPGEPDSLRCDTRAQLLLKGCPADDIMDPRSIANPEFDQRGQRKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLNNVKKLGGDLLQALNEITESGRIGFGSFVDKTVLPFVNTHPEKLRNPCPNKEKACQPPFAFRHVLKLTDNSNQFQTEVGKQLISGNLDAPEGGLDAIMQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNMYKRSNEFDYPSVGQLAHKLSESNIQPIFAVTKKMVKTYEKLTEIIPKSAVGELSDDSSNVVQLIKNAYYKLSSRVFLDHSTLPDTLKVTYDSFCSNGASSIGKSRGDCDGVQINNPVTFQVKVMASECIQEQSFVIRALGFTDTVTVQVRPQCECQCRDQSREQSLCGGKGVMECGICRCESGYIGKNCECQTQGRSSQELERNCRKDNSSIVCSGLGDCICGQCVCHTSDVPNKEIFGQYCECDNVNCERYNSQVCGGSDRGSCNCGKCSCKPGYEGSACQCQRSTTGCLNARLVECSGRGHCQCNRCICDEGYQPPMCEDCPSCGSHCRDNHTSCAECLKFDKGPFEKNCSVQCAGMTLQTIPLKKKPCKERDSEGCWITYTLQQKDGRNIYNIHVEDSLECVKGPN
• Sequence Length: 702

• Species: Mus musculus (Mouse)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 111607447
• NCBI GeneID: 16414
• NCBI Accession #: NP_032430.2
• NCBI GenBank Nucleotide #: NM_008404.4
• UniProt Accession #: P11835; Q64482
• Molecular Weight: 85,026 Da
• NCBI Official Full Name: integrin beta-2
• NCBI Official Synonym Full Names: integrin beta 2
• NCBI Official Symbol: Itgb2
• NCBI Official Synonym Symbols: 2E6; LAD; Cd18; Lfa1; MF17; LCAMB; AI528527
• NCBI Protein Information: integrin beta-2
• UniProt Protein Name: Integrin beta-2
• Protein Family: Integrin
• UniProt Gene Name: Itgb2

Uniprot Description

Integrin ITGAL/ITGB2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Integrins ITGAM/ITGB2 and ITGAX/ITGB2 are receptors for the iC3b fragment of the third complement component and for fibrinogen. Integrin ITGAX/ITGB2 recognizes the sequence G-P-R in fibrinogen alpha-chain. Integrin ITGAM/ITGB2 recognizes P1 and P2 peptides of fibrinogen gamma chain. Integrin ITGAM/ITGB2 is also a receptor for factor X. Integrin ITGAD/ITGB2 is a receptor for ICAM3 and VCAM1. Contributes to natural killer cell cytotoxicity (). Involved in leukocyte adhesion and transmigration of leukocytes including T-cells and neutrophils (). Triggers neutrophil transmigration during lung injury through PTK2B/PYK2-mediated activation (PubMed:18587400). Integrin ITGAL/ITGB2 in association with ICAM3, contributes to apoptotic neutrophil phagocytosis by macrophages (). In association with alpha subunit ITGAM/CD11b, required for CD177-PRTN3-mediated activation of TNF primed neutrophils (). Alpha-M/beta-2 play a critical role in mast cell development and in immune complex-mediated glomerulonephritis. Mice expressing a null mutation of the alpha-M subunit gene demonstrate increase in neutrophil accumulation, in response to a impaired degranulation and phagocytosis, events that apparently accelerate apoptosis in neutrophils. These mice develop obesity.