VEGFR-1/Flt-1(D7)-Fc Chimera, soluble Active Protein | VEGFR-1/Flt-1(D7) active protein

Mouse VEGFR-1/Flt-1(D7)-Fc Chimera, soluble

Cat. Num. AAA691661

• Gene Names: Flt1; Flt-1; sFlt1; VEGFR1; VEGFR-1; AI323757
• Reactivity: Mouse
• Purity: > 95% by SDS-PAGE & silver stain
• Synonyms: VEGFR-1/Flt-1(D7)-Fc Chimera; soluble; Mouse VEGFR-1/Flt-1(D7)-Fc Chimera; Recombinant Mouse Soluble VEGFR-1D7/Fc Chimera; Fms-like tyrosine kinase 1; Vascular permeability factor receptor; VEGFR-1/Flt-1(D7) active protein

• Host: Insect Cells
• Reactivity: Mouse
• Purity/Purification: > 95% by SDS-PAGE & silver stain
• Form/Format: Lyophilized
• Sequence: YGSGSKLKVPELSLKGTQHVMQAGQTLFLKCRGEAAHSWSLPTTVSQEDK RLSITPPSACGRDNRQFCSTLTLDTAQANHTGLYTCRYLPTSTSKKKKAE SSIYIFVSDAGSPFIEMHTDIPKLVHMTEGRQLIIPCRVTSPNVTVTLKK FPFDTLTPDGQRITWDSRRGFIIANATYKEIGLLNCEATVNGHLYQTNYL THRQTNTILDVQIRPPSPVRLLHGQTLVLNCTATTELNTRVQMSWNYPGK ATKRASIRQRIDRSHSHNNVFHSVLKINNVESRDKGLYTCRVKSGSSFQS FNTSVHVYEKGFISVKHRKQPVQETTAGRRSYRLSMKVKAFPSPEIVWLK DGSPATLKSARYLVHGYSLIIKDVTTEDAGDYTILLGIKQSRLFKNLTAT LIVNVKPQIYEKSVSSLPSPPLYPLGSRQVLTCTVYGIPRPTITWLWHPC HHNHSKERYDFCTENEESFILDPSSNLGNRIESISQRMTVIEGTNKTVST LVVADSQTPGIYSCRAFNKIGTVERNIKFYVTDVPNGFHVSLEKMPAEGE DLKLSCVVNKFLYRDITWILLRTVNNRTMHHSISKQKMATTQDYSITLNL VIKNVSLEDSGTYACRARNIYTGEDILRKTEVLVRDSEAPHLLQNLSDYE VSISGSTTLDCQARGVPAPQITWFKNNHKIQQEPGIILGPGNSTLFIERV TEEDEGVYRCRATNQKGAVESAAYLTVQGTSDKSNAASDKTHTCPPCPAP ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPI EKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWE SNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL HNHYTQKSLSLSPGK
• Sequence Length: 965

• N Terminal Sequence: SGSKLKD
• Buffer: PBS
• Preparation and Storage: Lyophilized samples are stable for greater than six months at -20 degree C to -70 degree C. Reconstituted sVEGFR-1/Fc should be stored in working aliquots at -20 degree C.

Testing Data

Related Product Information for VEGFR-1/Flt-1(D7) active protein

Recombinant human soluble Vascular Endothelial Growth Factor Receptor-1 (sVEGFR-1D1-7) was fused with the Fc part of human IgG1. The recombinant mature sVEGFR-1D1-7/Fc is a disulfide-linked homodimeric protein. The sVEGFR-1D1-7/Fc monomers have a mass of approximately 130 kDa. The soluble receptor protein consists of all 7 extracellular domains (Met1-Thr751), which contain all the information necessary for high affinity ligand binding. Endothelial cells express three different vascular endothelial growth factor (VEGF) receptors, belonging to the family of receptor tyrosine kinases (RTKs). They are named VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1), and VEGFR-3 (Flt-4). Their expression is almost exclusively restricted to endothelial cells, but VEGFR-1 can also be found on monocytes. All VEGF-receptors have seven immunoglobulin-like extracellular domains, a single transmembrane region and an intracellular split tyrosine kinase domain. VEGFR-2 has a lower affinity for VEGF than the Flt-1 receptor, but a higher signalling activity. Mitogenic activity in endothelial cells is mainly mediated by VEGFR-2 leading to their proliferation. Differential splicing of the flt-1 gene leads to the formation of a secreted, soluble variant of VEGFR-1 (sVEGFR-1). No naturally occurring, secreted forms of VEGFR-2 have so far been reported. The binding of VEGF165 to VEGFR-2 is dependent on heparin.

Product Categories/Family for VEGFR-1/Flt-1(D7) active protein

Soluble receptors

References

1. Barleon et al., 1997, J Biol Chem 272:10382-8 2. Röckl et al., 1998, Exp Cell Res, 241: 161-170.

NCBI and Uniprot Product Information

• NCBI GI #: 34328180
• NCBI GeneID: 14254
• NCBI Accession #: NP_034358.2
• NCBI GenBank Nucleotide #: NM_010228.3
• UniProt Accession #: P35969; O55094; Q61517
• Molecular Weight: 130 kDa (Monomer)
• NCBI Official Full Name: vascular endothelial growth factor receptor 1
• NCBI Official Synonym Full Names: FMS-like tyrosine kinase 1
• NCBI Official Symbol: Flt1
• NCBI Official Synonym Symbols: Flt-1; sFlt1; VEGFR1; VEGFR-1; AI323757
• NCBI Protein Information: vascular endothelial growth factor receptor 1; embryonic receptor kinase 2; tyrosine-protein kinase receptor FLT; vascular permeability factor receptor; vascular endothelial growth factor receptor-1
• UniProt Protein Name: Vascular endothelial growth factor receptor 1
• UniProt Gene Name: Flt1
• UniProt Synonym Gene Names: Emrk2; Flt; Vegfr1; VEGFR-1; FLT-1
• UniProt Entry Name: VGFR1_MOUSE

Uniprot Description

Function: Tyrosine-protein kinase that acts as a cell-surface receptor for VEGFA, VEGFB and PGF, and plays an essential role in the development of embryonic vasculature, the regulation of angiogenesis, cell survival, cell migration, macrophage function, chemotaxis, and cancer cell invasion. May play an essential role as a negative regulator of embryonic angiogenesis by inhibiting excessive proliferation of endothelial cells. Can promote endothelial cell proliferation, survival and angiogenesis in adulthood. Its function in promoting cell proliferation seems to be cell-type specific. Promotes PGF-mediated proliferation of endothelial cells, and proliferation of some types of cancer cells, but does not promote proliferation of normal fibroblasts. Has very high affinity for VEGFA and relatively low protein kinase activity; may function as a negative regulator of VEGFA signaling by limiting the amount of free VEGFA and preventing its binding to KDR. Modulates KDR signaling by forming heterodimers with KDR. Ligand binding leads to the activation of several signaling cascades. Activation of PLCG leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate and the activation of protein kinase C. Mediates phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, leading to the activation of phosphatidylinositol kinase and the downstream signaling pathway. Mediates activation of MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling pathway, as well as of the AKT1 signaling pathway. Phosphorylates SRC, YES1 and PLCG, and may also phosphorylate CBL. Promotes phosphorylation of AKT1 and PTK2/FAK1

By similarity. Ref.5 Ref.6 Ref.7 Ref.8 Ref.9 Ref.10

Catalytic activity: ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

Enzyme regulation: Present in an inactive conformation in the absence of bound ligand. Binding of VEGFA, VEGFB or PGF leads to dimerization and activation by autophosphorylation on tyrosine residues

By similarity.

Subunit structure: Interacts with VEGFA, VEGFB and PGF. Monomer in the absence of bound VEGFA, VEGFB or PGF. Homodimer in the presence of bound VEGFA, VEGFB and PGF. Can also form a heterodimer with KDR. Interacts (tyrosine phosphorylated) with CBL, CRK, GRB2, NCK1, PIK3R1, PLCG, PSEN1 and PTPN11. Probably interacts with PTPRB. Interacts with GNB2L1/RACK1. Identified in a complex with CBL and CD2AP

By similarity.

Subcellular location: Cell membrane; Single-pass type I membrane protein. Endosome

By similarity. Note: Autophosphorylation promotes ubiquitination and endocytosis

By similarity.

Domain: The second and third Ig-like C2-type (immunoglobulin-like) domains are sufficient for VEGFA binding

By similarity.

Post-translational modification: N-glycosylated

By similarity.Ubiquitinated after VEGFA-mediated autophosphorylation, leading to proteolytic degradation

By similarity.Autophosphorylated on tyrosine residues upon ligand binding. Autophosphorylation occurs in trans, i.e. one subunit of the dimeric receptor phosphorylates tyrosine residues on the other subunit. Phosphorylation at Tyr-1169 is important for interaction with PLCG. Phosphorylation at Tyr-1213 is important for interaction with PIK3R1, PTPN11, GRB2, and PLCG. Phosphorylation at Tyr-1328 is important for endocytosis and for interaction with CBL, NCK1 and CRK. Is probably dephosphorylated by PTPRB

By similarity.

Disruption phenotype: Embryonic lethality at about 9 dpc, due to defects in the formation and organization of the vascular network. Mice display abnormal blood island structures in the yolk sac, leading to defects in the organization of the vascular endothelium, excess growth and disorganization of embryonic and extraembryonic vasculature, including the endocardium and the microvasculature. Mice expressing a mutant protein that lacks the kinase domain survive and have no apparent phenotype. Ref.5 Ref.6 Ref.8

Sequence similarities: Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.Contains 7 Ig-like C2-type (immunoglobulin-like) domains.Contains 1 protein kinase domain.