Testing Data
(Detection limit for recombinant GST tagged NOP10 is 0.1 ng/ml as a capture antibody.)
Mouse NOP10 Monoclonal Antibody | anti-NOP10 antibody
NOP10 (NOP10 Ribonucleoprotein Homolog (yeast), MGC70651, NOLA3, NOP10P) (Biotin)
Gene Names
NOP10; DKCB1; NOLA3; NOP10P
Applications
Western Blot
Purity
Purified
Synonyms
NOP10; Monoclonal Antibody; NOP10 (NOP10 Ribonucleoprotein Homolog (yeast); MGC70651; NOLA3; NOP10P) (Biotin); NOP10 Ribonucleoprotein Homolog (yeast); NOP10P; anti-NOP10 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6H6
Specificity
Recognizes NOP10.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-NOP10 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
NOP10 (NP_061118.1, 1aa-64aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged NOP10 is 0.1 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged NOP10 is 0.1 ng/ml as a capture antibody.)
Product Categories/Family for anti-NOP10 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
7,706 Da
NCBI Official Full Name
H/ACA ribonucleoprotein complex subunit 3
NCBI Official Synonym Full Names
NOP10 ribonucleoprotein
NCBI Official Symbol
NOP10
NCBI Official Synonym Symbols
DKCB1; NOLA3; NOP10P
NCBI Protein Information
H/ACA ribonucleoprotein complex subunit 3; nucleolar protein 10; snoRNP protein NOP10; homolog of yeast Nop10p; NOP10 ribonucleoprotein homolog; nucleolar protein family A member 3; nucleolar protein family A, member 3 (H/ACA small nucleolar RNPs)
UniProt Protein Name
H/ACA ribonucleoprotein complex subunit 3
Protein Family
UniProt Gene Name
NOP10
UniProt Synonym Gene Names
NOLA3
UniProt Entry Name
NOP10_HUMAN
Similar Products
Product Notes
The NOP10 nop10 (Catalog #AAA6174537) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's NOP10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NOP10 nop10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NOP10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
