Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Interleukin-6 Recombinant Protein | IL6 recombinant protein

Recombinant Human Interleukin-6 protein

Gene Names
IL6; CDF; HGF; HSF; BSF2; IL-6; BSF-2; IFNB2; IFN-beta-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-6; Recombinant Human Interleukin-6 protein; B-cell stimulatory factor 2; BSF-2; CTL differentiation factor; CDF; Hybridoma growth factor; Interferon beta-2; IFN-beta-2; IL6 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
30-212aa; Full Length
Sequence
VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Sequence Length
212
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for IL6 recombinant protein
Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hatopoietic progenitor cells and cells of the CNS. Required for the generation of T(H)17 cells. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation.
Product Categories/Family for IL6 recombinant protein
References
Complementary DNA for a novel human interleukin (BSF-2) that induces B lymphocytes to produce immunoglobulin.Hirano T., Yasukawa K., Harada H., Taga T., Watanabe Y., Matsuda T., Kashiwamura S., Nakajima K., Koyama K., Iwamatsu A., Tsunasawa S., Sakiyama F., Matsui H., Takahara Y., Taniguchi T., Kishimoto T.Nature 324:73-76(1986) Structure and expression of human B cell stimulatory factor-2 (BSF-2/IL-6) gene.Yasukawa K., Hirano T., Watanabe Y., Muratani K., Matsuda T., Nakai S., Kishimoto T.EMBO J. 6:2939-2945(1987) Anti-beta-interferon antibodies inhibit the increased expression of HLA-B7 mRNA in tumor necrosis factor-treated human fibroblasts structural studies of the beta 2 interferon involved.May L.T., Helfgott D.C., Sehgal P.B.Proc. Natl. Acad. Sci. U.S.A. 83:8957-8961(1986) Structure and expression of cDNA and genes for human interferon-beta-2, a distinct species inducible by growth-stimulatory cytokines.Zilberstein A., Ruggieri R., Korn J.H., Revel M.EMBO J. 5:2529-2537(1986) Molecular cloning and expression of hybridoma growth factor in Escherichia coli.Brakenhoff J.P.J., de Groot E.R., Evers R.F., Pannekoek H., Aarden L.A.J. Immunol. 139:4116-4121(1987) Deletion of 3' untranslated region of human BSF-2 mRNA causes stabilization of the mRNA and high-level expression in mouse NIH3T3 cells.Tonouchi N., Miwa K., Karasuyama H., Matsui H.Biochem. Biophys. Res. Commun. 163:1056-1062(1989) Structural analysis of the sequence coding for an inducible 26-kDa protein in human fibroblasts.Haegeman G., Content J., Volckaert G., Derynck R., Tavernier J., Fiers W.Eur. J. Biochem. 159:625-632(1986) Interleukin 6 identification as a hematopoietic colony-stimulating factor.Wong G., Witek-Giannotti J., Hewick R., Clark S., Ogawa M.Behring Inst. Mitt. 83:40-47(1988) Stable and efficient expression of human interleukin-6 cDNA in mammalian cells after gene transfer.Chen Q.Y.Zhonghua Zhong Liu Za Zhi 14:340-344(1992) SeattleSNPs variation discovery resource Separation and comparison of two monokines with lymphocyte-activating factor activity IL-1 beta and hybridoma growth factor (HGF) . Identification of leukocyte-derived HGF as IL-6.van Damme J., van Beeumen J., Decock B., van Snick J., de Ley M., Billiau A.J. Immunol. 140:1534-1541(1988) Interleukin 6 is the principal cytolytic T lymphocyte differentiation factor for thymocytes in human leukocyte conditioned medium.Ming J.E., Cernetti C., Steinman R.M., Granelli-Piperno A.J. Mol. Cell. Immunol. 4:203-211(1989) Marked cell-type-specific differences in glycosylation of human interleukin-6.May L.T., Shaw J.E., Khanna A.K., Zabriskie J.B., Sehgal P.B.Cytokine 3:204-211(1991) Structure, stability and biological properties of a N-terminally truncated form of recombinant human interleukin-6 containing a single disulfide bond.Breton J., la Fiura A., Bertolero F., Orsini G., Valsasina B., Ziliotto R., de Filippis V., Polverino de Laureto P., Fontana A.Eur. J. Biochem. 227:573-581(1995) Disulfide structures of human interleukin-6 are similar to those of human granulocyte colony stimulating factor.Clogston C.L., Boone T.C., Crandall B.C., Mendiaz E.A., Lu H.S.Arch. Biochem. Biophys. 272:144-151(1989) Evidence for the importance of a positive charge and an alpha-helical structure of the C-terminus for biological activity of human IL-6.Luetticken C., Kruettgen A., Moeller C., Heinrich P.C., Rose-John S.FEBS Lett. 282:265-267(1991) Folding topologies of human interleukin-6 and its mutants as studied by NMR spectroscopy.Nishimura C., Watanabe A., Gouda H., Shimada I., Arata Y.Biochemistry 35:273-281(1996) Solution structure of recombinant human interleukin-6.Xu G.-Y., Yu H.-A., Hong J., Stahl M., McDonagh T., Kay L.E., Cumming D.A.J. Mol. Biol. 268:468-481(1997) 1.9-A crystal structure of interleukin 6 implications for a novel mode of receptor dimerization and signaling.Somers W., Stahl M., Seehra J.S.EMBO J. 16:989-997(1997) The effect of novel polymorphisms in the interleukin-6 (IL-6) gene on IL-6 transcription and plasma IL-6 levels, and an association with systemic-onset juvenile chronic arthritis.Fishman D., Faulds G., Jeffery R., Mohamed-Ali V., Yudkin J.S., Humphries S., Woo P.J. Clin. Invest. 102:1369-1376(1998) An IL6 promoter polymorphism is associated with a lifetime risk of development of Kaposi sarcoma in men infected with human immunodeficiency virus.Foster C.B., Lehrnbecher T., Samuels S., Stein S., Mol F., Metcalf J.A., Wyvill K., Steinberg S.M., Kovacs J., Blauvelt A., Yarchoan R., Chanock S.J.Blood 96:2562-2567(2000) A nucleotide variant in the promoter region of the interleukin-6 gene associated with decreased bone mineral density.Ota N., Nakajima T., Nakazawa I., Suzuki T., Hosoi T., Orimo H., Inoue S., Shirai Y., Emi M.J. Hum. Genet. 46:267-272(2001) Association of interleukin-6 promoter variant with bone mineral density in pre-menopausal women.Chung H.W., Seo J.-S., Hur S.E., Kim H.L., Kim J.Y., Jung J.H., Kim L.H., Park B.L., Shin H.D.J. Hum. Genet. 48:243-248(2003)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48.2kD
NCBI Official Full Name
interleukin-6 isoform 1
NCBI Official Synonym Full Names
interleukin 6
NCBI Official Symbol
IL6
NCBI Official Synonym Symbols
CDF; HGF; HSF; BSF2; IL-6; BSF-2; IFNB2; IFN-beta-2
NCBI Protein Information
interleukin-6
UniProt Protein Name
Interleukin-6
Protein Family
UniProt Gene Name
IL6
UniProt Synonym Gene Names
IFNB2; IL-6; BSF-2; CDF; IFN-beta-2
UniProt Entry Name
IL6_HUMAN

NCBI Description

This gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]

Uniprot Description

IL6: Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig- secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. Genetic variations in IL6 are associated with susceptibility to rheumatoid arthritis systemic juvenile (RASJ). An inflammatory articular disorder with systemic- onset beginning before the age of 16. It represents a subgroup of juvenile arthritis associated with severe extraarticular features and occasionally fatal complications. During active phases of the disorder, patients display a typical daily spiking fever, an evanescent macular rash, lymphadenopathy, hepatosplenomegaly, serositis, myalgia and arthritis. A IL6 promoter polymorphism is associated with a lifetime risk of development of Kaposi sarcoma in HIV-infected men. Belongs to the IL-6 superfamily.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 7p21

Cellular Component: cytoplasm; external side of plasma membrane; extracellular region; extracellular space; interleukin-6 receptor complex

Molecular Function: cytokine activity; growth factor activity; interleukin-6 receptor binding; protein binding

Biological Process: activation of NF-kappaB transcription factor; acute-phase response; aging; bone remodeling; cell growth; cell redox homeostasis; cytokine and chemokine mediated signaling pathway; defense response to Gram-negative bacterium; defense response to Gram-positive bacterium; defense response to protozoan; defense response to virus; endocrine pancreas development; glucose homeostasis; hepatic immune response; humoral immune response; inflammatory response; monocyte chemotaxis; muscle maintenance; negative regulation of apoptosis; negative regulation of caspase activity; negative regulation of cell proliferation; negative regulation of chemokine biosynthetic process; negative regulation of collagen biosynthetic process; negative regulation of cytokine secretion; negative regulation of fat cell differentiation; negative regulation of gluconeogenesis; negative regulation of hormone secretion; negative regulation of muscle development; negative regulation of protein kinase activity; neurite development; neutrophil apoptosis; neutrophil mediated immunity; platelet activation; positive regulation of acute inflammatory response; positive regulation of apoptosis; positive regulation of B cell activation; positive regulation of cell proliferation; positive regulation of chemokine production; positive regulation of DNA replication; positive regulation of epithelial cell proliferation; positive regulation of immunoglobulin secretion; positive regulation of interleukin-6 production; positive regulation of JAK-STAT cascade; positive regulation of leukocyte chemotaxis; positive regulation of MAPKKK cascade; positive regulation of neuron differentiation; positive regulation of nitric oxide biosynthetic process; positive regulation of osteoblast differentiation; positive regulation of peptidyl-serine phosphorylation; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of protein import into nucleus, translocation; positive regulation of protein kinase B signaling cascade; positive regulation of smooth muscle cell proliferation; positive regulation of T cell proliferation; positive regulation of T-helper 2 cell differentiation; positive regulation of transcription factor activity; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; positive regulation of translation; positive regulation of transmission of nerve impulse; positive regulation of tyrosine phosphorylation of Stat3 protein; regulation of angiogenesis; regulation of cell shape; regulation of circadian sleep/wake cycle, non-REM sleep; response to amino acid stimulus; response to antibiotic; response to caffeine; response to calcium ion; response to cold; response to drug; response to electrical stimulus; response to glucocorticoid stimulus; response to heat; response to insulin stimulus; response to nutrient levels; response to peptidoglycan; response to yeast

Disease: Arteriovenous Malformations Of The Brain; Inflammatory Bowel Disease 1; Kaposi Sarcoma, Susceptibility To; Rheumatoid Arthritis, Systemic Juvenile

Research Articles on IL6

Similar Products

Product Notes

The IL6 il6 (Catalog #AAA1265464) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 30-212aa; Full Length. The amino acid sequence is listed below: VPPGEDSKDV AAPHRQPLTS SERIDKQIRY ILDGISALRK ETCNKSNMCE SSKEALAENN LNLPKMAEKD GCFQSGFNEE TCLVKIITGL LEFEVYLEYL QNRFESSEEQ ARAVQMSTKV LIQFLQKKAK NLDAITTPDP TTNASLLTKL QAQNQWLQDM TTHLILRSFK EFLQSSLRAL RQM. It is sometimes possible for the material contained within the vial of "Interleukin-6, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.