Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human IL-1RL2/IL-1 Receptor-Like 2 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

IL-1RL2/IL-1 Receptor-Like 2 Recombinant Protein | IL-1RL2 recombinant protein

Recombinant Human IL-1RL2/IL-1 Receptor-Like 2 Protein

Gene Names
IL1RL2; IL-36R; IL1RRP2; IL-1Rrp2; IL1R-rp2
Purity
>95% by SDS-PAGE.
Synonyms
IL-1RL2/IL-1 Receptor-Like 2; Recombinant Human IL-1RL2/IL-1 Receptor-Like 2 Protein; Interleukin-1 receptor-like 2; IL1RL2; IL-36 receptor; IL-36R; IL-1Rrp2; IL1R-rp2; IL-1RL2 recombinant protein
Ordering
For Research Use Only!
Host
Human Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.
Sequence
DGCKDIFMKNEILSASQPFAFNCTFPPITSGEVSVTWYKNSSKIPVSKIIQSRIHQDETWILFLPMEWGDSGVYQCVIKGRDSCHRIHVNLTVFEKHWCDTSIGGLPNLSDEYKQILHLGKDDSLTCHLHFPKSCVLGPIKWYKDCNEIKGERFTVLETRLLVSNVSAEDRGNYACQAILTHSGKQYEVLNGITVSITERAGYGGSVPKIIYPKNHSIEVQLGTTLIVDCNVTDTKDNTNLRCWRVNNTLVDDYY
Sequence Length
575
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human IL-1RL2/IL-1 Receptor-Like 2 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

SDS-Page (Recombinant Human IL-1RL2/IL-1 Receptor-Like 2 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
Related Product Information for IL-1RL2 recombinant protein
Description: Recombinant Human IL-1RL2/IL-1 Receptor-Like 2 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Asp20-Tyr337) of human IL-1RL2/IL-1 Receptor-Like 2 (Accession #Q9HB29) fused with a 6xHis tag at the C-terminus.

Background: Interleukin-1 receptor-like 2 is a protein that in humans is encoded by the IL1RL2 gene, belongs to theinterleukin-1 receptor family.IL1RL2 is the receptor for interleukin-36 (IL36A, IL36B and IL36G). After binding tointerleukin-36 associates with the coreceptor IL1RAP to form the interleukin-36 receptor complex whichmediates interleukin-36-dependent activation of NF-kappa-B, MAPK and other pathways.
Product Categories/Family for IL-1RL2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interleukin-1 receptor-like 2 isoform a
NCBI Official Synonym Full Names
interleukin 1 receptor like 2
NCBI Official Symbol
IL1RL2
NCBI Official Synonym Symbols
IL-36R; IL1RRP2; IL-1Rrp2; IL1R-rp2
NCBI Protein Information
interleukin-1 receptor-like 2
UniProt Protein Name
Interleukin-1 receptor-like 2
UniProt Gene Name
IL1RL2
UniProt Synonym Gene Names
IL1RRP2; IL-36R; IL-1Rrp2; IL1R-rp2
UniProt Entry Name
ILRL2_HUMAN

NCBI Description

The protein encoded by this gene is a member of the interleukin 1 receptor family. An experiment with transient gene expression demonstrated that this receptor was incapable of binding to interleukin 1 alpha and interleukin 1 beta with high affinity. This gene and four other interleukin 1 receptor family genes, including interleukin 1 receptor, type I (IL1R1), interleukin 1 receptor, type II (IL1R2), interleukin 1 receptor-like 1 (IL1RL1), and interleukin 18 receptor 1 (IL18R1), form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. [provided by RefSeq, Jul 2008]

Uniprot Description

IL1RL2: Receptor for interleukin 1 family member 9 (IL1F9). Binding to the agonist leads to the activation of NF-kappa-B. Belongs to the interleukin-1 receptor family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q12

Cellular Component: integral to plasma membrane

Molecular Function: interleukin-1, Type I, activating receptor activity; interleukin-1 receptor activity

Biological Process: positive regulation of T cell differentiation; cytokine and chemokine mediated signaling pathway; regulation of inflammatory response; innate immune response; positive regulation of interleukin-6 production; cellular defense response; inflammatory response; signal transduction

Research Articles on IL-1RL2

Similar Products

Product Notes

The IL-1RL2 il1rl2 (Catalog #AAA9140065) is a Recombinant Protein produced from Human Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: DGCKDIFMKN EILSASQPFA FNCTFPPITS GEVSVTWYKN SSKIPVSKII QSRIHQDETW ILFLPMEWGD SGVYQCVIKG RDSCHRIHVN LTVFEKHWCD TSIGGLPNLS DEYKQILHLG KDDSLTCHLH FPKSCVLGPI KWYKDCNEIK GERFTVLETR LLVSNVSAED RGNYACQAIL THSGKQYEVL NGITVSITER AGYGGSVPKI IYPKNHSIEV QLGTTLIVDC NVTDTKDNTN LRCWRVNNTL VDDYY. It is sometimes possible for the material contained within the vial of "IL-1RL2/IL-1 Receptor-Like 2, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.