Interleukin-15 Recombinant Protein | IL15 recombinant protein

Recombinant human Interleukin-15 protein

Cat. Num. AAA717324

• Gene Names: IL15; IL-15
• Applications: SDS-Page, ELISA
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Interleukin-15; Recombinant human Interleukin-15 protein; Interleukin-15 His tagged; IL15 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence: NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

• Applicable Applications for IL15 recombinant protein: SDS-PAGE, ELISA
• Preparation and Storage: Store working aliquots at 4 degree C for up to one week. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended.

Related Product Information for IL15 recombinant protein

Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.

References

[1] "Cloning of a T cell growth factor that interacts with the beta chain of the interleukin-2 receptor." Grabstein K.H., Eisenman J., Shanebeck K., Rauch C., Srinivasan S., Fung V., Beers C., Richardson J., Schoenborn M.A., Ahdieh M., Johnson L., Alderson M.R., Watson J.D., Anderson D.M., Giri J.G. Science 264:965-968(1994) [PubMed: 8178155] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IL15-S48AA). Tissue: Bone marrow.
[2] "Genomic sequence and chromosomal location of the human interleukin-15 gene (IL15)." Krause H., Jandrig B., Wernicke C., Bulfone-Paus S., Pohl T., Diamantstein T. Cytokine 8:667-674(1996) [PubMed: 8932977] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
[3] "Identification of a novel interleukin-15 (IL-15) transcript isoform generated by alternative splicing in human small cell lung cancer cell lines." Meazza R., Verdiani S., Biassoni R., Coppolecchia M., Gaggero A., Orengo A.M., Colombo M.P., Azzarone B., Ferrini S. Oncogene 12:2187-2192(1996) [PubMed: 8668345] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IL15-S21AA). Tissue: Lung cancer.
[4] "Generation of secretable and nonsecretable interleukin 15 isoforms through alternate usage of signal peptides." Tagaya Y., Kurys G., Thies T.A., Losi J.M., Azimi N., Hanover J.A., Bamford R.N., Waldmann T.A. Proc. Natl. Acad. Sci. U.S.A. 94:14444-14449(1997) [PubMed: 9405632] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IL15-S21AA). Tissue: Testis.
[5] "Expression of two IL-15 mRNA isoforms in human tumors does not correlate with secretion: role of different signal peptides." Meazza R., Ferrini S. Submitted (APR-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA].

NCBI and Uniprot Product Information

• NCBI GI #: 47523834
• NCBI GeneID: 397683
• NCBI Accession #: NP_999555.1
• NCBI GenBank Nucleotide #: NM_214390.1
• UniProt Accession #: Q95253; Q195F8
• Molecular Weight: 19 kDa
• NCBI Official Full Name: interleukin-15
• NCBI Official Symbol: IL15
• NCBI Official Synonym Symbols: IL-15
• NCBI Protein Information: interleukin-15
• UniProt Protein Name: Interleukin-15
• Protein Family: Interleukin
• UniProt Gene Name: IL15
• UniProt Synonym Gene Names: IL-15
• UniProt Entry Name: IL15_PIG

Uniprot Description

Function: Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha

By similarity.

Subcellular location: Secreted.

Sequence similarities: Belongs to the IL-15/IL-21 family.