Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Interleukin-15 Recombinant Protein | IL15 recombinant protein

Recombinant human Interleukin-15 protein

Gene Names
IL15; IL-15
Applications
SDS-Page, ELISA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-15; Recombinant human Interleukin-15 protein; Interleukin-15 His tagged; IL15 recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence
NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Applicable Applications for IL15 recombinant protein
SDS-PAGE, ELISA
Preparation and Storage
Store working aliquots at 4 degree C for up to one week. For extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended.
Related Product Information for IL15 recombinant protein
Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha.
References
[1] "Cloning of a T cell growth factor that interacts with the beta chain of the interleukin-2 receptor." Grabstein K.H., Eisenman J., Shanebeck K., Rauch C., Srinivasan S., Fung V., Beers C., Richardson J., Schoenborn M.A., Ahdieh M., Johnson L., Alderson M.R., Watson J.D., Anderson D.M., Giri J.G. Science 264:965-968(1994) [PubMed: 8178155] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IL15-S48AA). Tissue: Bone marrow.
[2] "Genomic sequence and chromosomal location of the human interleukin-15 gene (IL15)." Krause H., Jandrig B., Wernicke C., Bulfone-Paus S., Pohl T., Diamantstein T. Cytokine 8:667-674(1996) [PubMed: 8932977] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
[3] "Identification of a novel interleukin-15 (IL-15) transcript isoform generated by alternative splicing in human small cell lung cancer cell lines." Meazza R., Verdiani S., Biassoni R., Coppolecchia M., Gaggero A., Orengo A.M., Colombo M.P., Azzarone B., Ferrini S. Oncogene 12:2187-2192(1996) [PubMed: 8668345] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IL15-S21AA). Tissue: Lung cancer.
[4] "Generation of secretable and nonsecretable interleukin 15 isoforms through alternate usage of signal peptides." Tagaya Y., Kurys G., Thies T.A., Losi J.M., Azimi N., Hanover J.A., Bamford R.N., Waldmann T.A. Proc. Natl. Acad. Sci. U.S.A. 94:14444-14449(1997) [PubMed: 9405632] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM IL15-S21AA). Tissue: Testis.
[5] "Expression of two IL-15 mRNA isoforms in human tumors does not correlate with secretion: role of different signal peptides." Meazza R., Ferrini S. Submitted (APR-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA].

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19 kDa
NCBI Official Full Name
interleukin-15
NCBI Official Symbol
IL15
NCBI Official Synonym Symbols
IL-15
NCBI Protein Information
interleukin-15
UniProt Protein Name
Interleukin-15
Protein Family
UniProt Gene Name
IL15
UniProt Synonym Gene Names
IL-15
UniProt Entry Name
IL15_PIG

Uniprot Description

Function: Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha

By similarity.

Subcellular location: Secreted.

Sequence similarities: Belongs to the IL-15/IL-21 family.

Research Articles on IL15

Similar Products

Product Notes

The IL15 il15 (Catalog #AAA717324) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Interleukin-15 can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, ELISA. Researchers should empirically determine the suitability of the IL15 il15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NWVNVISDLK KIEDLIQSMH IDATLYTESD VHPSCKVTAM KCFLLELQVI SLESGDASIH DTVENLIILA NNSLSSNGNV TESGCKECEE LEEKNIKEFL QSFVHIVQMF INTS. It is sometimes possible for the material contained within the vial of "Interleukin-15, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual