Interleukin-11 (Il11) Recombinant Protein | Il11 recombinant protein
Recombinant Mouse Interleukin-11 (Il11), Biotinylated
Gene Names
Il11; IL-11
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interleukin-11 (Il11); Recombinant Mouse Interleukin-11 (Il11); Biotinylated; IL-11; Il11 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-199aa, Full Length of Mature Protein
Sequence
PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Species
Mus musculus (Mouse)
Relevance
Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production (PubMed:8913282). Also promotes the proliferation of hepatocytes in response to liver damage (PubMed:22253262). Binding to its receptor formed by IL6ST and either IL11RA1 or IL11RA2 activates a signaling cascade that promotes cell proliferation, also in the context of various cancers (PubMed:10026196, PubMed:23948300). Signaling leads to the activation of intracellular protein kinases and the phosphorylation of STAT3 (PubMed:23948300, PubMed:22253262). The interaction with the membrane-bound IL11RA and IL6ST stimulates 'classic signaling', whereas the binding of IL11 and soluble IL11RA to IL6ST stimulates 'trans-signaling' (By similarity)
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
Product Categories/Family for Il11 recombinant protein
References
"Interleukin-11 is the dominant IL-6 family cytokine during gastrointestinal tumorigenesis and can be targeted therapeutically."Putoczki T.L., Thiem S., Loving A., Busuttil R.A., Wilson N.J., Ziegler P.K., Nguyen P.M., Preaudet A., Farid R., Edwards K.M., Boglev Y., Luwor R.B., Jarnicki A., Horst D., Boussioutas A., Heath J.K., Sieber O.M., Pleines I. Ernst M.Cancer Cell 24:257-271(2013)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,522 Da
NCBI Official Full Name
interleukin-11 isoform 1
NCBI Official Synonym Full Names
interleukin 11
NCBI Official Symbol
Il11
NCBI Official Synonym Symbols
IL-11
NCBI Protein Information
interleukin-11
UniProt Protein Name
Interleukin-11
Protein Family
UniProt Gene Name
Il11
UniProt Synonym Gene Names
IL-11
UniProt Entry Name
IL11_MOUSE
Uniprot Description
IL11: Directly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. Belongs to the IL-6 superfamily.
Protein type: Secreted, signal peptide; Motility/polarity/chemotaxis; Cell cycle regulation; Cytokine
Cellular Component: extracellular space; cytoplasm; extracellular region
Molecular Function: growth factor activity; cytokine activity; interleukin-11 receptor binding
Biological Process: positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of MAPKKK cascade; negative regulation of hormone secretion; positive regulation of cell proliferation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of peptidyl-serine phosphorylation
Research Articles on Il11
Similar Products
Product Notes
The Il11 il11 (Catalog #AAA9018503) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-199aa, Full Length of Mature Protein. The amino acid sequence is listed below: PGPPAGSPRV SSDPRADLDS AVLLTRSLLA DTRQLAAQMR DKFPADGDHS LDSLPTLAMS AGTLGSLQLP GVLTRLRVDL MSYLRHVQWL RRAGGPSLKT LEPELGALQA RLERLLRRLQ LLMSRLALPQ AAPDQPVIPL GPPASAWGSI RAAHAILGGL HLTLDWAVRG LLLLKTRL. It is sometimes possible for the material contained within the vial of "Interleukin-11 (Il11), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
