Attachment protein G3P (III) Recombinant Protein | III recombinant protein

Recombinant Enterobacteria phage f1 Attachment protein G3P (III)

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Attachment protein G3P (III); Recombinant Enterobacteria phage f1 Attachment protein G3P (III); Recombinant Attachment protein G3P (III); Attachment protein G3P; Gene 3 protein; G3P Minor coat protein; III recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 19-424
• Sequence: AETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENEGGGSEGGGSEGGGSEGGGTKPPEYGDTPIPGYTYINPLDGTYPPGTEQNPANPNPSLEESQPLNTFMFQNNRFRNRQGALTVYTGTVTQGTDPVKTYYQYTPVSSKAMYDAYWNGKFRDCAFHSGFNEDPFVCEYQGQSSDLPQPPVNAGGGSGGGSGGGSEGGGSEGGGSEGGGSEGGGSGGGSGSGDFDYEKMANANKGAMTENADENALQSDAKGKLDSVATDYGAAIDGFIGDVSGLANGNGATGDFAGSNSQMAQVGDGDNSPLMNNFRQYLPSLPQSVECRPFVFGAGKPYEFSIDCDKINLFRGVFAFLLYVATFMYVFSTFANILRNKES
• Sequence Length: 424

• Species: Enterobacteria phage f1 (Bacteriophage f1)
• Preparation and Storage: Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

• NCBI GI #: 59802858
• UniProt Accession #: P69169; P03662
• Molecular Weight: 44,622 Da
• NCBI Official Full Name: Attachment protein G3P
• UniProt Protein Name: Attachment protein G3P
• Protein Family: Attachment protein
• UniProt Gene Name: III
• UniProt Synonym Gene Names: G3P
• UniProt Entry Name: G3P_BPF1

Uniprot Description

Function: Plays essential roles both in the entry of the viral genome into the bacterial host and in the budding process. During the initial step of infection, G3P mediates adsorption of the phage to its primary receptor, the tip of host F-pilus. Subsequent interaction with the host coreceptor tolA induces injection of the viral DNA into the host cytoplasm. In the budding process, G3P mediates the release of the membrane-anchored virion from the cell via its C-terminal domain

By similarity.

Subunit structure: Interacts with G6P; this interaction is required for proper integration of G3P and G6P into the virion. Interacts with G8P

By similarity. Interacts with host tolA

By similarity.

Subcellular location: Virion

Potential. Host membrane; Single-pass type I membrane protein

Potential. Note: Prior to assembly, G3P is found associated with the bacterial host inner membrane. There are about five copies of this protein per mature phage that are located on the head side of the filamentous virion.

Domain: Consists of three domains (N1, N2, and CT). The N2 domain interacts with the F pilus, whereas the N1 domain forms a complex with the C-terminal domain of tolA at later stages of the infection process. N1 is connected to N2 by a flexible glycine-rich linker on the phage. The C-terminal domain is required for release of viral particles from the host bacterial membrane and proper integration of G3P and G6P proteins in the virion.

Sequence similarities: Belongs to the inovirus G3P protein family.