Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CLUAP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: ACHN cell lysateCLUAP1 is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells)

Rabbit CLUAP1 Polyclonal Antibody | anti-CLUAP1 antibody

CLUAP1 antibody - C-terminal region

Gene Names
CLUAP1; FAP22; IFT38; CFAP22
Reactivity
Tested: Human
Predicted: Cow, Goat, Horse, Human, Mouse, Pig, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CLUAP1; Polyclonal Antibody; CLUAP1 antibody - C-terminal region; anti-CLUAP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested: Human
Predicted: Cow, Goat, Horse, Human, Mouse, Pig, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: RIVGTMQGGDSDDNEDSEESEIDMEDDDDEDDDLEDESISLSPTKPNRRV
Sequence Length
413
Applicable Applications for anti-CLUAP1 antibody
Western Blot (WB)
Application Notes
Blocking Peptide: MBS3237027
Predicted Homology Based on Immunogen Sequence
Cow: 86%; Goat: 85%; Horse: 79%; Human: 100%; Mouse: 92%; Pig: 79%; Rat: 92%; Yeast: 92%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CLUAP1
Protein Size (# AA)
413 amino acids
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CLUAP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: ACHN cell lysateCLUAP1 is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells)

Western Blot (WB) (WB Suggested Anti-CLUAP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: ACHN cell lysateCLUAP1 is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells)
Related Product Information for anti-CLUAP1 antibody
This is a rabbit polyclonal antibody against CLUAP1. It was validated on Western Blot

Target Description: CLUAP1 may play a role in cell proliferation or apoptosis.
Product Categories/Family for anti-CLUAP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
clusterin-associated protein 1 isoform 1
NCBI Official Synonym Full Names
clusterin associated protein 1
NCBI Official Symbol
CLUAP1
NCBI Official Synonym Symbols
FAP22; IFT38; CFAP22
NCBI Protein Information
clusterin-associated protein 1
UniProt Protein Name
Clusterin-associated protein 1
UniProt Gene Name
CLUAP1
UniProt Synonym Gene Names
KIAA0643
UniProt Entry Name
CLUA1_HUMAN

NCBI Description

The protein encoded by this gene contains a single coiled-coil region. Alternative splicing results in multiple transcript variants and protein isoforms. [provided by RefSeq, Jul 2012]

Research Articles on CLUAP1

Similar Products

Product Notes

The CLUAP1 cluap1 (Catalog #AAA3212080) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CLUAP1 antibody - C-terminal region reacts with Tested: Human Predicted: Cow, Goat, Horse, Human, Mouse, Pig, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CLUAP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Blocking Peptide: MBS3237027. Researchers should empirically determine the suitability of the CLUAP1 cluap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RIVGTMQGGD SDDNEDSEES EIDMEDDDDE DDDLEDESIS LSPTKPNRRV. It is sometimes possible for the material contained within the vial of "CLUAP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.